Elongation of very long chain fatty acids protein 3 (Elovl3) Recombinant Protein | Elovl3 recombinant protein
Recombinant Mouse Elongation of very long chain fatty acids protein 3 (Elovl3)
Gene Names
Elovl3; CIN-2; Cig30
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Elongation of very long chain fatty acids protein 3 (Elovl3); Recombinant Mouse Elongation of very long chain fatty acids protein 3 (Elovl3); Recombinant Elongation of very long chain fatty acids protein 3 (Elovl3); Elongation of very long chain fatty acids protein 3 EC= 2.3.1.n8; 3-keto acyl-CoA synthase Elovl3 CIN-2 Cold-inducible glycoprotein of 30 kDa ELOVL fatty acid elongase 3; ELOVL FA e; Elovl3 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-271
Sequence
MDTSMNFSRGLKMDLMQPYDFETFQDLRPFLEEYWVSSFLIVVVYLLLIVVGQTYMRTRKSFSLQRPLILWSFFLAIFSILGTLRMWKFMATVMFTVGLKQTVCFAIYTDDAVVRFWSFLFLLSKVVELGDTAFIILRKRPLIFVHWYHHSTVLLFTSFGYKNKVPSGGWFMTMNFGVHSVMYTYYTMKAAKLKHPNLLPMVITSLQILQMVLGTIFGILNYIWRQEKGCHTTTEHFFWSFMLYGTYFILFAHFFHRAYLRPKGKVASKSQ
Sequence Length
271
Species
Mus musculus (Mouse)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32,060 Da
NCBI Official Full Name
elongation of very long chain fatty acids protein 3
NCBI Official Synonym Full Names
elongation of very long chain fatty acids (FEN1/Elo2, SUR4/Elo3, yeast)-like 3
NCBI Official Symbol
Elovl3
NCBI Official Synonym Symbols
CIN-2; Cig30
NCBI Protein Information
elongation of very long chain fatty acids protein 3; ELOVL FA elongase 3; ELOVL fatty acid elongase 3; cold inducible glycoprotein 30; 3-keto acyl-CoA synthase Elovl3; cold-inducible glycoprotein of 30 kDa; very-long-chain 3-oxoacyl-CoA synthase 3; elongation of very long chain fatty acids-like 3
UniProt Protein Name
Elongation of very long chain fatty acids protein 3
Protein Family
UniProt Gene Name
Elovl3
UniProt Synonym Gene Names
Cig30; ELOVL FA elongase 3
UniProt Entry Name
ELOV3_MOUSE
Uniprot Description
ELOVL3: Condensing enzyme that elongates saturated and monounsaturated very long chain fatty acids (VLCFAs). Highest activity toward C18 acyl-CoAs, especially C18:0 acyl-CoAs. Belongs to the ELO family.
Protein type: Membrane protein, integral; EC 2.3.1.199; Membrane protein, multi-pass
Cellular Component: membrane; endoplasmic reticulum; integral to membrane
Molecular Function: transferase activity
Biological Process: very-long-chain fatty acid biosynthetic process; lipid metabolic process; fatty acid elongation, saturated fatty acid; fatty acid metabolic process; fatty acid biosynthetic process
Research Articles on Elovl3
Similar Products
Product Notes
The Elovl3 elovl3 (Catalog #AAA1034122) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-271. The amino acid sequence is listed below: MDTSMNFSRG LKMDLMQPYD FETFQDLRPF LEEYWVSSFL IVVVYLLLIV VGQTYMRTRK SFSLQRPLIL WSFFLAIFSI LGTLRMWKFM ATVMFTVGLK QTVCFAIYTD DAVVRFWSFL FLLSKVVELG DTAFIILRKR PLIFVHWYHH STVLLFTSFG YKNKVPSGGW FMTMNFGVHS VMYTYYTMKA AKLKHPNLLP MVITSLQILQ MVLGTIFGIL NYIWRQEKGC HTTTEHFFWS FMLYGTYFIL FAHFFHRAYL RPKGKVASKS Q. It is sometimes possible for the material contained within the vial of "Elongation of very long chain fatty acids protein 3 (Elovl3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
