Probable [NiFe]-hydrogenase-type-3 Eha complex membrane subunit A (ehaA) Recombinant Protein | MTH384 recombinant protein
Recombinant Methanothermobacter thermautotrophicus Probable [NiFe]-hydrogenase-type-3 Eha complex membrane subunit A (ehaA)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Probable [NiFe]-hydrogenase-type-3 Eha complex membrane subunit A (ehaA); Recombinant Methanothermobacter thermautotrophicus Probable [NiFe]-hydrogenase-type-3 Eha complex membrane subunit A (ehaA); Recombinant Probable [NiFe]-hydrogenase-type-3 Eha complex membrane subunit A (ehaA); Probable [NiFe]-hydrogenase-type-3 Eha complex membrane subunit A; MTH384 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-97
Sequence
MIIHVTYLSGYLAAIISSIIVSAILGLPLTPERPARHSWTPSAIFPTPVIALGLTAISIKLGVTGIYGADLGAVAGVLSAIMTAYFLEDIFPRPEDS
Sequence Length
105
Species
Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) (Methanobacterium thermoautotrophicum)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
10,166 Da
NCBI Official Full Name
hypothetical protein MTH384
NCBI Official Symbol
MTH384
NCBI Protein Information
hypothetical protein
UniProt Protein Name
Probable [NiFe]-hydrogenase-type-3 Eha complex membrane subunit A
UniProt Gene Name
ehaA
UniProt Entry Name
EHAA_METTH
Uniprot Description
Function: One of the integral membrane subunits of multisubunit membrane-bound [NiFe]-hydrogenase eha. Eha is predicted to form large electron transfer complex and might catalyze energy-driven reduction of low-potential redox carriers
By similarity.
Subunit structure: Putative multisubunit membrane-bound [NiFe]-hydrogenase eha is composed of at least 20 subunits
By similarity.
Subcellular location: Cell membrane; Multi-pass membrane protein
Potential.
Sequence similarities: Belongs to the EhaA family.
Sequence caution: The sequence AAB84890.1 differs from that shown. Reason: Erroneous initiation.
Similar Products
Product Notes
The MTH384 ehaa (Catalog #AAA1048863) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-97. The amino acid sequence is listed below: MIIHVTYLSG YLAAIISSII VSAILGLPLT PERPARHSWT PSAIFPTPVI ALGLTAISIK LGVTGIYGAD LGAVAGVLSA IMTAYFLEDI FPRPEDS. It is sometimes possible for the material contained within the vial of "Probable [NiFe]-hydrogenase-type-3 Eha complex membrane subunit A (ehaA), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
