Egl nine homolog 3 (Egln3) Recombinant Protein | Egln3 recombinant protein

Recombinant Rat Egl nine homolog 3 (Egln3)

Cat. Num. AAA1394007

• Gene Names: Egln3; PHD3; PHD-3; SM-20
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Egl nine homolog 3 (Egln3); Recombinant Rat Egl nine homolog 3 (Egln3); Egln3 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-239, full length protein
• Sequence: MPLGHIMRLDLEKIALEYIVPCLHEVGFCYLDNFLGEVVGDCVLERVKQLHYNGALRDGQLAGPRAGVSKRHLRGDQITWIGGNEEGCEAINFLLSLIDRLVLYCGSRLGKYYVKERSKAMVACYPGNGTGYVRHVDNPNGDGRCITCIYYLNKNWDAKLHGGVLRIFPEGKSFVADVEPIFDRLLFSWSDRRNPHEVQPSYATRYAMTVWYFDAEERAEAKKKFRNLTRKTESALAKD
• Sequence Length: 239

• Species: Rat
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 9507123
• NCBI GeneID: 54702
• NCBI Accession #: NP_062244.1
• NCBI GenBank Nucleotide #: NM_019371.1
• UniProt Accession #: Q62630
• Molecular Weight: 27,242 Da
• NCBI Official Full Name: egl nine homolog 3
• NCBI Official Synonym Full Names: egl-9 family hypoxia-inducible factor 3
• NCBI Official Symbol: Egln3
• NCBI Official Synonym Symbols: PHD3; PHD-3; SM-20
• NCBI Protein Information: egl nine homolog 3
• UniProt Protein Name: Egl nine homolog 3
• Protein Family: Egl nine
• UniProt Gene Name: Egln3
• UniProt Synonym Gene Names: Sm20; HIF-PH3; HIF-prolyl hydroxylase 3; HPH-3; PHD3

NCBI Description

plays a role in regulation of cell proliferation [RGD, Feb 2006]

Uniprot Description

Plays a crucial role in DNA damage response (DDR) by hydroxylating TELO2, promoting its interaction with ATR which is required for activation of the ATR/CHK1/p53 pathway (). Cellular oxygen sensor that catalyzes, under normoxic conditions, the post-translational formation of 4-hydroxyproline in hypoxia-inducible factor (HIF) alpha proteins. Hydroxylates a specific proline found in each of the oxygen-dependent degradation (ODD) domains (N-terminal, NODD, and C-terminal, CODD) of HIF1A. Also hydroxylates HIF2A. Has a preference for the CODD site for both HIF1A and HIF2A. Hydroxylation on the NODD site by EGLN3 appears to require prior hydroxylation on the CODD site. Hydroxylated HIFs are then targeted for proteasomal degradation via the von Hippel-Lindau ubiquitination complex. Under hypoxic conditions, the hydroxylation reaction is attenuated allowing HIFs to escape degradation resulting in their translocation to the nucleus, heterodimerization with HIF1B, and increased expression of hypoxy-inducible genes. ELGN3 is the most important isozyme in limiting physiological activation of HIFs (particularly HIF2A) in hypoxia. Also hydroxylates PKM in hypoxia, limiting glycolysis. Under normoxia, hydroxylates and regulates the stability of ADRB2. Regulator of cardiomyocyte and neuronal apoptosis. In cardiomyocytes, inhibits the anti-apoptotic effect of BCL2 by disrupting the BAX-BCL2 complex. In neurones, has a NGF-induced proapoptotic effect, probably through regulating CASP3 activity. Also essential for hypoxic regulation of neutrophilic inflammation. Target proteins are preferentially recognized via a LXXLAP motif.