Egl nine homolog 1 (Egln1) Recombinant Protein | Egln1 recombinant protein

Recombinant Mouse Egl nine homolog 1 (Egln1)

Cat. Num. AAA1314092

• Gene Names: Egln1; Phd2; HPH-2; ORF13; SM-20; C1orf12; HIF-PH2; AI503754; Hif-p4h-2
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Egl nine homolog 1 (Egln1); Recombinant Mouse Egl nine homolog 1 (Egln1); Egln1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 2-400, full length protein
• Sequence: ASDSGGPGVLSASERDRQYCELCGKMENLLRCGRCRSSFYCCKEHQRQDWKKHKLVCQGGEAPRAQPAPAQPRVAPPPGGAPGAARAGGAARRGDSAAASRVPGPEDAAQARSGPGPAEPGSEDPPLSRSPGPERASLCPAGGGPGEALSPGGGLRPNGQTKPLPALKLALEYIVPCMNKHGICVVDDFLGRETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDQITWIEGKEPGCETIGLLMSSMDDLIRHCSGKLGNYRINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKYLTGEKGVRVELKPNSVSKDV
• Sequence Length: 399

• Species: Mouse
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for Egln1 recombinant protein

This protein catalyzes the post-translational formation of 4-hydroxyproline in hypoxia-inducible factor (HIF) alpha proteins. HIF is a transcriptional complex that plays a central role in mammalian oxygen homeostasis. This protein functions as a cellular oxygen sensor, and under normal oxygen concentration, modification by prolyl hydroxylation is a key regulatory event that targets HIF subunits for proteasomal destruction via the von Hippel-Lindau ubiquitylation complex. Mutations in this gene are associated with erythrocytosis familial type 3 (ECYT3).

NCBI and Uniprot Product Information

• NCBI GI #: 158303306
• NCBI GeneID: 112405
• NCBI Accession #: NP_444437.2
• NCBI GenBank Nucleotide #: NM_053207.2
• UniProt Accession #: Q91YE3; Q8VHJ2; Q922P3
• Molecular Weight: 43,111 Da
• NCBI Official Full Name: egl nine homolog 1
• NCBI Official Synonym Full Names: egl-9 family hypoxia-inducible factor 1
• NCBI Official Symbol: Egln1
• NCBI Official Synonym Symbols: Phd2; HPH-2; ORF13; SM-20; C1orf12; HIF-PH2; AI503754; Hif-p4h-2
• NCBI Protein Information: egl nine homolog 1
• UniProt Protein Name: Egl nine homolog 1
• Protein Family: Egl nine
• UniProt Gene Name: Egln1
• UniProt Synonym Gene Names: HIF-PH2; HIF-prolyl hydroxylase 2; HPH-2; PHD2

Uniprot Description

Cellular oxygen sensor that catalyzes, under normoxic conditions, the post-translational formation of 4-hydroxyproline in hypoxia-inducible factor (HIF) alpha proteins. Hydroxylates a specific proline found in each of the oxygen-dependent degradation (ODD) domains (N-terminal, NODD, and C-terminal, CODD) of HIF1A. Also hydroxylates HIF2A. Has a preference for the CODD site for both HIF1A and HIF1B. Hydroxylated HIFs are then targeted for proteasomal degradation via the von Hippel-Lindau ubiquitination complex. Under hypoxic conditions, the hydroxylation reaction is attenuated allowing HIFs to escape degradation resulting in their translocation to the nucleus, heterodimerization with HIF1B, and increased expression of hypoxy-inducible genes. EGLN1 is the most important isozyme under normoxia and, through regulating the stability of HIF1, involved in various hypoxia-influenced processes such as angiogenesis in retinal and cardiac functionality. Target proteins are preferentially recognized via a LXXLAP motif.