SDS-PAGE
Epidermal growth factor-like protein 8 (Egfl8) Recombinant Protein | Egfl8 recombinant protein
Recombinant Mouse Epidermal growth factor-like protein 8 (Egfl8)
Gene Names
Egfl8; Ng3
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Epidermal growth factor-like protein 8 (Egfl8); Recombinant Mouse Epidermal growth factor-like protein 8 (Egfl8); Epidermal growth factor-like protein 8; EGF-like protein 8; Egfl8 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
29-293aa; Full Length of Mature Protein
Sequence
GSFKESLGVCSKQTLLVPLRYNESYSQPVYKPYLTLCAGRRICSTYRTTYRVAWREVRREVPQTHVVCCQGWKKPHPGALTCDAICSKPCLNGGVCTGPDRCECAPGWGGKHCHVDVDECRASLTLCSHGCLNTLGSFLCSCPHPLVLGLDGRTCAGGPPESPTSASILSVAVREADSEEERALRWEVAELRGRLEKLEQWATQAGAWVRAVLPMPPEELRPEQVAELWGRGDRIESLSDQVLLLEERLGACACEDNSLGPSLRG
Sequence Length
265
Species
Mus musculus (Mouse)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
SDS-PAGE
SDS-PAGE
Related Product Information for Egfl8 recombinant protein
Interacting selectively and non-covalently with calcium ions (Ca2+).
Product Categories/Family for Egfl8 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
49 kDa
NCBI Official Full Name
epidermal growth factor-like protein 8
NCBI Official Synonym Full Names
EGF-like domain 8
NCBI Official Symbol
Egfl8
NCBI Official Synonym Symbols
Ng3
NCBI Protein Information
epidermal growth factor-like protein 8; EGF-like protein 8
UniProt Protein Name
Epidermal growth factor-like protein 8
Protein Family
UniProt Gene Name
Egfl8
UniProt Synonym Gene Names
Ng3; EGF-like protein 8
UniProt Entry Name
EGFL8_MOUSE
Uniprot Description
EGFL8:
Protein type: Membrane protein, integral; Calcium-binding; Secreted, signal peptide; Secreted
Cellular Component: extracellular region
Molecular Function: calcium ion binding
Research Articles on Egfl8
Similar Products
Product Notes
The Egfl8 egfl8 (Catalog #AAA1471009) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 29-293aa; Full Length of Mature Protein. The amino acid sequence is listed below: GSFKESLGVC SKQTLLVPLR YNESYSQPVY KPYLTLCAGR RICSTYRTTY RVAWREVRRE VPQTHVVCCQ GWKKPHPGAL TCDAICSKPC LNGGVCTGPD RCECAPGWGG KHCHVDVDEC RASLTLCSHG CLNTLGSFLC SCPHPLVLGL DGRTCAGGPP ESPTSASILS VAVREADSEE ERALRWEVAE LRGRLEKLEQ WATQAGAWVR AVLPMPPEEL RPEQVAELWG RGDRIESLSD QVLLLEERLG ACACEDNSLG PSLRG. It is sometimes possible for the material contained within the vial of "Epidermal growth factor-like protein 8 (Egfl8), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
