Ephrin-B1 Recombinant Protein | efnb1 recombinant protein
Ephrin-B1
Gene Names
efnb1; cfnd; cfns; efl3; eplg2; lerk2; LERK-2; efnb1-A; ephrinB1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Ephrin-B1; efnb1 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
21-329aa; full length protein
Sequence
LGKNLEPVTWNSQNPRFISGKGLVLYPEIGDRLDIICPKGDSSQPYEYYKLYMVRRDQLEACSTVIDPNVLVTCNQPGKEYRFTIKFQEFSPNYMGLEFRRNQDYYITSTSNSTLQGLENREGGVCQTRSMKIIMKVGQDPNAVPPEQLTTTRPSKEADNTGKIATFGPWNGPVENPGKSDTNLSDKPTAGGGVDGFFNSKIAVFAAIGAGCVIFILIIIFLVVLLIKIRKRHRKHTQQRAAALSLSTLASPKCSGNAGSEPSDIIIPLRTTENNYCPHYEKVSGDYGHPVYIVQEMPPQSPANIYYKV
Sequence Length
Full Length Protein
Species
Xenopus laevis (African clawed frog)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for efnb1 recombinant protein
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Product Categories/Family for efnb1 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36,593 Da
NCBI Official Full Name
ephrin-B1
NCBI Official Synonym Full Names
ephrin-B1
NCBI Official Symbol
efnb1
NCBI Official Synonym Symbols
cfnd; cfns; efl3; eplg2; lerk2; LERK-2; efnb1-A; ephrinB1
NCBI Protein Information
ephrin-B1
UniProt Protein Name
Ephrin-B1
Protein Family
UniProt Gene Name
efnb1
UniProt Synonym Gene Names
eplg2; lerk2; ELK-L; LERK-2
UniProt Entry Name
EFNB1_XENLA
Uniprot Description
Cell surface transmembrane ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. Binds promiscuously Eph receptors residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling (). May have a role in the developing mesenchymal and nervous tissue.
Research Articles on efnb1
Similar Products
Product Notes
The efnb1 efnb1 (Catalog #AAA7042654) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 21-329aa; full length protein. The amino acid sequence is listed below: LGKNLEPVTW NSQNPRFISG KGLVLYPEIG DRLDIICPKG DSSQPYEYYK LYMVRRDQLE ACSTVIDPNV LVTCNQPGKE YRFTIKFQEF SPNYMGLEFR RNQDYYITST SNSTLQGLEN REGGVCQTRS MKIIMKVGQD PNAVPPEQLT TTRPSKEADN TGKIATFGPW NGPVENPGKS DTNLSDKPTA GGGVDGFFNS KIAVFAAIGA GCVIFILIII FLVVLLIKIR KRHRKHTQQR AAALSLSTLA SPKCSGNAGS EPSDIIIPLR TTENNYCPHY EKVSGDYGHP VYIVQEMPPQ SPANIYYKV. It is sometimes possible for the material contained within the vial of "Ephrin-B1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
