Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Ephrin-B1 Recombinant Protein | Efnb1 recombinant protein

Ephrin-B1

Gene Names
Efnb1; LERK2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Ephrin-B1; Efnb1 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
25-345aa; full length protein
Sequence
ATPLAKNLEPVSWSSLNPKFLSGKGLVIYPKIGDKLDIICPRAEAGRPYEYYKLYLVRPEQAAACSTVLDPNVLVTCNKPQQEIRFTIKFQEFSPNYMGLEFKKYHDYYITSTSNGSLEGLENREGGVCRTRTMKIVMKVGQDPNAVTPEQLTTSRPSKESDNTVKTATQAPGRGSQGDSDGKHETVNQQEKSGPGAGGSGSGDTDSFFNSKVALFAAVGAGCVIFLLIIIFLTVLLLKLRKRHRKHTQQRAAALSLSTLASPKGDSGTAGTEPSDIIIPLRTTENNYCPHYEKVSGDYGHPVYIVQEMPPQSPANIYYKV
Sequence Length
Full Length Protein
Species
Rattus norvegicus (Rat)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for Efnb1 recombinant protein
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Product Categories/Family for Efnb1 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
37,951 Da
NCBI Official Full Name
Ephrin-B1
NCBI Official Synonym Full Names
ephrin B1
NCBI Official Symbol
Efnb1
NCBI Official Synonym Symbols
LERK2
NCBI Protein Information
ephrin-B1
UniProt Protein Name
Ephrin-B1
Protein Family
UniProt Gene Name
Efnb1
UniProt Synonym Gene Names
Eplg2; Lerk2; ELK-L; LERK-2
UniProt Entry Name
EFNB1_RAT

NCBI Description

induces neurite outgrowth; may play a role in positive regulation of cerebellar development [RGD, Feb 2006]

Uniprot Description

EFNB1: a type I membrane protein of the ephrin family. A ligand of Eph-related receptor tyrosine kinases EphB1 and EphA1. Ephrins and ephrin receptors mediate numerous developmental processes, particularly in the nervous system. Ephrin-B1 may play a role in cell adhesion and functions in the development or maintenance of the nervous system. Binding to its receptor induces the collapse of commissural axons/growth cones in vitro. Induced by TNF-alpha. Expressed in brain, heart, placenta, lung, liver, skeletal muscle, kidney, and pancreas.

Protein type: Ligand, receptor tyrosine kinase; Membrane protein, integral

Cellular Component: cytoplasm; lipid raft; nucleus; plasma membrane; synapse

Molecular Function: ephrin receptor binding; protein binding

Biological Process: axon guidance; embryonic pattern specification; ephrin receptor signaling pathway; nervous system development; neural crest cell migration; positive regulation of T cell proliferation; T cell costimulation

Research Articles on Efnb1

Similar Products

Product Notes

The Efnb1 efnb1 (Catalog #AAA7042653) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 25-345aa; full length protein. The amino acid sequence is listed below: ATPLAKNLEP VSWSSLNPKF LSGKGLVIYP KIGDKLDIIC PRAEAGRPYE YYKLYLVRPE QAAACSTVLD PNVLVTCNKP QQEIRFTIKF QEFSPNYMGL EFKKYHDYYI TSTSNGSLEG LENREGGVCR TRTMKIVMKV GQDPNAVTPE QLTTSRPSKE SDNTVKTATQ APGRGSQGDS DGKHETVNQQ EKSGPGAGGS GSGDTDSFFN SKVALFAAVG AGCVIFLLII IFLTVLLLKL RKRHRKHTQQ RAAALSLSTL ASPKGDSGTA GTEPSDIIIP LRTTENNYCP HYEKVSGDYG HPVYIVQEMP PQSPANIYYK V. It is sometimes possible for the material contained within the vial of "Ephrin-B1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.