EF-hand domain-containing protein 1 (Efhc1) Recombinant Protein | Efhc1 recombinant protein
Recombinant Mouse EF-hand domain-containing protein 1 (Efhc1)
Gene Names
Efhc1; mRib72-1; myoclonin1; 1700029F22Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
EF-hand domain-containing protein 1 (Efhc1); Recombinant Mouse EF-hand domain-containing protein 1 (Efhc1); Efhc1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-648, Full length protein
Sequence
MGTNPVHGLPFLPGSSFTDSTKTAFHRSQTLNYRNGYAVVRRPTMGIGGDRLHYNQLSQAELDELANKAPILTYGPLKQAPLAEFVPAHVAFDKKVLKFSAYFQEDVPISMEEHYRIRHVNIYYYLEDDSMSVIEPVVENSGIPQGKLIKRQRFTKNDMGDHYHWKDLNRGINLTVYGKTFRIVDCDRFTQDFLESQGIELNPSEKIPLDPYTQLRKEPVRKYVTPSDFDQLKQFLTFDKQVLRFYAIWDDTDSLFGECRHYIIHYYLMDDTVEIREVHERNNGRDPFPLLMNRQRMPKVLVENAKNFPKCVLEISDQEVLEWYTAKDFIVGKPLTILGRTFFIYDCDPFTRQFYKDKFGMPDLPPVDVTKKEPPPVKQELPPYNGYGLIEDSAQNCFALIPKAPRKDVVKMLMNDNKVLRYLAALESPIPEDKDRRFVFSYFLATDMISIFEPPVRNSGIIGGKFLGRTKVVKSFSPVDNPIYYSPSDFFIGAVIEVFGHRFVILDTDEYVLKYMESNASQYSPEALASIQNRIQKPELPAPELESKQATGEPMVQGTEESKVQDLDALIDQIHMHLKYNSYKENLRETFQMYDKDESGYVDRETFFKICETLNVPVDDSLIKELIRLCTHGEGRINYYNFVRAFSN
Sequence Length
648
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
75,142 Da
NCBI Official Full Name
EF-hand domain-containing protein 1
NCBI Official Synonym Full Names
EF-hand domain (C-terminal) containing 1
NCBI Official Symbol
Efhc1
NCBI Official Synonym Symbols
mRib72-1; myoclonin1; 1700029F22Rik
NCBI Protein Information
EF-hand domain-containing protein 1
UniProt Protein Name
EF-hand domain-containing protein 1
Protein Family
UniProt Gene Name
Efhc1
Uniprot Description
Microtubule-associated protein which regulates cell division and neuronal migration during cortical development. Necessary for mitotic spindle organization. Necessary for radial and tangential cell migration during brain development, possibly acting as a regulator of cell morphology and process formation during migration (). May enhance calcium influx through CACNA1E and stimulate programmed cell death. Overexpression of EFHC1 in hippocampal primary culture neurons induced apoptosis.
Research Articles on Efhc1
Similar Products
Product Notes
The Efhc1 efhc1 (Catalog #AAA1464409) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-648, Full length protein. The amino acid sequence is listed below: MGTNPVHGLP FLPGSSFTDS TKTAFHRSQT LNYRNGYAVV RRPTMGIGGD RLHYNQLSQA ELDELANKAP ILTYGPLKQA PLAEFVPAHV AFDKKVLKFS AYFQEDVPIS MEEHYRIRHV NIYYYLEDDS MSVIEPVVEN SGIPQGKLIK RQRFTKNDMG DHYHWKDLNR GINLTVYGKT FRIVDCDRFT QDFLESQGIE LNPSEKIPLD PYTQLRKEPV RKYVTPSDFD QLKQFLTFDK QVLRFYAIWD DTDSLFGECR HYIIHYYLMD DTVEIREVHE RNNGRDPFPL LMNRQRMPKV LVENAKNFPK CVLEISDQEV LEWYTAKDFI VGKPLTILGR TFFIYDCDPF TRQFYKDKFG MPDLPPVDVT KKEPPPVKQE LPPYNGYGLI EDSAQNCFAL IPKAPRKDVV KMLMNDNKVL RYLAALESPI PEDKDRRFVF SYFLATDMIS IFEPPVRNSG IIGGKFLGRT KVVKSFSPVD NPIYYSPSDF FIGAVIEVFG HRFVILDTDE YVLKYMESNA SQYSPEALAS IQNRIQKPEL PAPELESKQA TGEPMVQGTE ESKVQDLDAL IDQIHMHLKY NSYKENLRET FQMYDKDESG YVDRETFFKI CETLNVPVDD SLIKELIRLC THGEGRINYY NFVRAFSN. It is sometimes possible for the material contained within the vial of "EF-hand domain-containing protein 1 (Efhc1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
