Elongation factor 1-gamma (EEF1G) Recombinant Protein | EEF1G recombinant protein
Recombinant Human Elongation factor 1-gamma (EEF1G)
Gene Names
EEF1G; EF1G; GIG35
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Elongation factor 1-gamma (EEF1G); Recombinant Human Elongation factor 1-gamma (EEF1G); EEF1G recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-437, Full length protein
Sequence
AAGTLYTYPENWRAFKALIAAQYSGAQVRVLSAPPHFHFGQTNRTPEFLRKFPAGKVPAFEGDDGFCVFESNAIAYYVSNEELRGSTPEAAAQVVQWVSFADSDIVPPASTWVFPTLGIMHHNKQATENAKEEVRRILGLLDAYLKTRTFLVGERVTLADITVVCTLLWLYKQVLEPSFRQAFPNTNRWFLTCINQPQFRAVLGEVKLCEKMAQFDAKKFAETQPKKDTPRKEKGSREEKQKPQAERKEEKKAAAPAPEEEMDECEQALAAEPKAKDPFAHLPKSTFVLDEFKRKYSNEDTLSVALPYFWEHFDKDGWSLWYSEYRFPEELTQTFMSCNLITGMFQRLDKLRKNAFASVILFGTNNSSSISGVWVFRGQELAFPLSPDWQVDYESYTWRKLDPGSEETQTLVREYFSWEGAFQHVGKAFNQGKIFK
Sequence Length
436
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for EEF1G recombinant protein
This gene encodes a subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This subunit contains an N-terminal glutathione transferase domain, which may be involved in regulating the assembly of multisubunit complexes containing this elongation factor and aminoacyl-tRNA synthetases.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
56,150 Da
NCBI Official Full Name
elongation factor 1-gamma
NCBI Official Synonym Full Names
eukaryotic translation elongation factor 1 gamma
NCBI Official Symbol
EEF1G
NCBI Official Synonym Symbols
EF1G; GIG35
NCBI Protein Information
elongation factor 1-gamma
UniProt Protein Name
Elongation factor 1-gamma
Protein Family
UniProt Gene Name
EEF1G
UniProt Synonym Gene Names
EF1G; EF-1-gamma
NCBI Description
This gene encodes a subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This subunit contains an N-terminal glutathione transferase domain, which may be involved in regulating the assembly of multisubunit complexes containing this elongation factor and aminoacyl-tRNA synthetases. [provided by RefSeq, Jul 2008]
Uniprot Description
Probably plays a role in anchoring the complex to other cellular components.
Research Articles on EEF1G
Similar Products
Product Notes
The EEF1G eef1g (Catalog #AAA1059855) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-437, Full length protein. The amino acid sequence is listed below: AAGTLYTYPE NWRAFKALIA AQYSGAQVRV LSAPPHFHFG QTNRTPEFLR KFPAGKVPAF EGDDGFCVFE SNAIAYYVSN EELRGSTPEA AAQVVQWVSF ADSDIVPPAS TWVFPTLGIM HHNKQATENA KEEVRRILGL LDAYLKTRTF LVGERVTLAD ITVVCTLLWL YKQVLEPSFR QAFPNTNRWF LTCINQPQFR AVLGEVKLCE KMAQFDAKKF AETQPKKDTP RKEKGSREEK QKPQAERKEE KKAAAPAPEE EMDECEQALA AEPKAKDPFA HLPKSTFVLD EFKRKYSNED TLSVALPYFW EHFDKDGWSL WYSEYRFPEE LTQTFMSCNL ITGMFQRLDK LRKNAFASVI LFGTNNSSSI SGVWVFRGQE LAFPLSPDWQ VDYESYTWRK LDPGSEETQT LVREYFSWEG AFQHVGKAFN QGKIFK. It is sometimes possible for the material contained within the vial of "Elongation factor 1-gamma (EEF1G), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
