Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Early E1A 27 kDa protein Recombinant Protein | E1A recombinant protein

Recombinant Human adenovirus F serotype 40 Early E1A 27 kDa protein

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Early E1A 27 kDa protein; Recombinant Human adenovirus F serotype 40 Early E1A 27 kDa protein; E1A recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-249aa; Full Length
Sequence
MRMLPDFFTGNWDDMFQGLLETEYVFDFPEPSEASEEMSLHDLFDVEVDGFEEDANQEAVDGMFPERLLSEAESAAESGSGDSGVGEELLPVDLDLKCYEDGLPPSDPETDEATEAEEEAAMPTYVNENENELVLDCPENPGRGCRACDFHRGTSGNPEAMCALCYMRLTGHCIYSPISDAEGESESGSPEDTDFPHPLTATPPHGIVRTIPCRVSCRRRPAVECIEDLLEEDPTDEPLNLSLKRPKCS
Species
Human adenovirus F serotype 40 (HAdV-40) (Human adenovirus 40)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24,365 Da
NCBI Official Full Name
control protein E1A
NCBI Official Symbol
E1A
NCBI Protein Information
alternative splicing utilizing nonconserved sites may produce additional proteins
UniProt Protein Name
Early E1A protein

Uniprot Description

Plays a role in viral genome replication by driving entry of quiescent cells into the cell cycle. Stimulation of progression from G1 to S phase allows the virus to efficiently use the cellular DNA replicating machinery to achieve viral genome replication. E1A protein has both transforming and trans-activating activities. Induces the disassembly of the E2F1 transcription factor from RB1 by direct competition for the same binding site on RB1, with subsequent transcriptional activation of E2F1-regulated S-phase genes and of the E2 region of the adenoviral genome. Release of E2F1 leads to the ARF-mediated inhibition of MDM2 and causes TP53/p53 to accumulate because it is not targeted for degradation by MDM2-mediated ubiquitination anymore. This increase in TP53, in turn, would arrest the cell proliferation and direct its death but this effect is counteracted by the viral protein E1B-55K. Inactivation of the ability of RB1 to arrest the cell cycle is critical for cellular transformation, uncontrolled cellular growth and proliferation induced by viral infection. Interaction with RBX1 and CUL1 inhibits ubiquitination of the proteins targeted by SCF(FBXW7) ubiquitin ligase complex, and may be linked to unregulated host cell proliferation. The tumorigenesis-restraining activity of E1A may be related to the disruption of the host CtBP-CtIP complex through the CtBP binding motif. Interaction with host TMEM173/STING impairs the ability of TMEM173/STING to sense cytosolic DNA and promote the production of type I interferon (IFN-alpha and IFN-beta).

Similar Products

Product Notes

The E1A (Catalog #AAA1007316) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-249aa; Full Length. The amino acid sequence is listed below: MRMLPDFFTG NWDDMFQGLL ETEYVFDFPE PSEASEEMSL HDLFDVEVDG FEEDANQEAV DGMFPERLLS EAESAAESGS GDSGVGEELL PVDLDLKCYE DGLPPSDPET DEATEAEEEA AMPTYVNENE NELVLDCPEN PGRGCRACDF HRGTSGNPEA MCALCYMRLT GHCIYSPISD AEGESESGSP EDTDFPHPLT ATPPHGIVRT IPCRVSCRRR PAVECIEDLL EEDPTDEPLN LSLKRPKCS . It is sometimes possible for the material contained within the vial of "Early E1A 27 kDa protein, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.