Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Enhancer of yellow 2 transcription factor (e (y)2) Recombinant Protein | e(y)2 recombinant protein

Recombinant Drosophila ananassae Enhancer of yellow 2 transcription factor (e (y)2)

Gene Names
DanaGF20364; dana_GLEANR_2774; GF20364
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Enhancer of yellow 2 transcription factor (e (y)2); Recombinant Drosophila ananassae Enhancer of yellow 2 transcription factor (e (y)2); e(y)2 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-100, Full length protein
Sequence
MTVSNTVDQYTVLSGDRSKIKDLLCNRLTECGWRDEVRLLCRTILLEKGTGNSFTVEQLITEVTPKARTLVPDAVKKELLMKIRTILTENESEIEDAEEP
Sequence Length
100
Species
Drosophila ananassae (Fruit fly)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
11,354 Da
NCBI Official Full Name
uncharacterized protein Dana_GF20364, isoform A
NCBI Official Symbol
DanaGF20364
NCBI Official Synonym Symbols
dana_GLEANR_2774; GF20364
NCBI Protein Information
GF20364 gene product from transcript GF20364-RB
UniProt Protein Name
Enhancer of yellow 2 transcription factor
UniProt Gene Name
e(y)2

Uniprot Description

Involved in mRNA export coupled transcription activation by association with both the AMEX and the SAGA complexes. The SAGA complex is a multiprotein complex that activates transcription by remodeling chromatin and mediating histone acetylation and deubiquitination. Within the SAGA complex, participates in a subcomplex that specifically deubiquitinates histone H2B. The SAGA complex is recruited to specific gene promoters by activators, where it is required for transcription. Required for nuclear receptor-mediated transactivation. Involved in transcription elongation by recruiting the THO complex onto nascent mRNA. The AMEX complex functions in docking export-competent ribonucleoprotein particles (mRNPs) to the nuclear entrance of the nuclear pore complex (nuclear basket). AMEX participates in mRNA export and accurate chromatin positioning in the nucleus by tethering genes to the nuclear periphery ().

Similar Products

Product Notes

The e(y)2 e(y)2 (Catalog #AAA1188728) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-100, Full length protein. The amino acid sequence is listed below: MTVSNTVDQY TVLSGDRSKI KDLLCNRLTE CGWRDEVRLL CRTILLEKGT GNSFTVEQLI TEVTPKARTL VPDAVKKELL MKIRTILTEN ESEIEDAEEP. It is sometimes possible for the material contained within the vial of "Enhancer of yellow 2 transcription factor (e (y)2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.