Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

E1B protein, large T-antigen Recombinant Protein | E1B-55K recombinant protein

Recombinant Human adenovirus F serotype 41 E1B protein, large T-antigen

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
E1B protein; large T-antigen; Recombinant Human adenovirus F serotype 41 E1B protein; E1B-55K recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-472, Full length protein
Sequence
MERPNPSVGGIYSGLHDNGPVENPAAEEEGLRLLAGAASARSGSSAGGGGGGGGGGEPEGRSGSSNGIVTEPDPEEGTSSGQRGEKRKLENDGADFLKELTLSLMSRCYPESVWWADLEDEFKNGNMNLLYKYGFEQLKTHWMEPWEDWELALNMFAKVALRPDTIYTIKKTVNIRKCAYVIGNGAVVRFQTFDRVVFNCAMQSLGPGVIGMSGVTFNNVRFAADGFNGKVFASTTQLTLHGVFFQNCSGVCVDSWGRVSARGCTFVGCWKGLVGQNKSQMSVKKCVFERCILAMVVEGQARIRHNAGSENVCFLLLKGTASVKHNMICGTGHSQLLTCADGNCQTLKVIHVVSHQRRPWPVFEHNMLMRCTMHLGARRGMFSPYQSNFCHTKVLMETDAFSRVWWSGVFDLTIELYKVVRYDELKARCRPCECGANHIRLYPATLNVTEQLRTDHQMLSCLRTDYESSDED
Sequence Length
472
Species
Human adenovirus F serotype 41 (HAdV-41) (Human adenovirus 41)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
UniProt Accession #
Molecular Weight
52,157 Da
NCBI Official Full Name
E1B 55 kDa protein
UniProt Protein Name
E1B 55 kDa protein
UniProt Gene Name
E1B-55K
UniProt Synonym Gene Names
E1B-55K

Uniprot Description

Plays a major role to prevent cellular inhibition of viral genome replication. Assembles an SCF-like E3 ubiquitin ligase complex based on the cellular proteins ELOB, ELOC, CUL5 and RBX1, in cooperation with viral E4orf6. This viral RING-type ligase ubiquitinates cellular substrates and targets them to proteasomal degradation: TP53/p53, LIG4, MRE11-RAD50-NBS1 (MRN) complex, ITGA3, DAXX and BLM. Degradation of host TP53/p53 activity is essential for preventing E1A-induced TP53 accumulation that would otherwise lead to cell apoptosis and growth arrest. E1B-55K also inactivates TP53 transcription-factor activity by binding its transactivation domain. E1B-55K also functions as a SUMO1 E3 ligase for TP53 which causes the latter to be sequestered in promyelocytic leukemia (PML) nuclear bodies thereby contributing to maximal inhibition of TP53 function.

Similar Products

Product Notes

The E1B protein, large T-antigen e1b-55k (Catalog #AAA1260943) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-472, Full length protein. The amino acid sequence is listed below: MERPNPSVGG IYSGLHDNGP VENPAAEEEG LRLLAGAASA RSGSSAGGGG GGGGGGEPEG RSGSSNGIVT EPDPEEGTSS GQRGEKRKLE NDGADFLKEL TLSLMSRCYP ESVWWADLED EFKNGNMNLL YKYGFEQLKT HWMEPWEDWE LALNMFAKVA LRPDTIYTIK KTVNIRKCAY VIGNGAVVRF QTFDRVVFNC AMQSLGPGVI GMSGVTFNNV RFAADGFNGK VFASTTQLTL HGVFFQNCSG VCVDSWGRVS ARGCTFVGCW KGLVGQNKSQ MSVKKCVFER CILAMVVEGQ ARIRHNAGSE NVCFLLLKGT ASVKHNMICG TGHSQLLTCA DGNCQTLKVI HVVSHQRRPW PVFEHNMLMR CTMHLGARRG MFSPYQSNFC HTKVLMETDA FSRVWWSGVF DLTIELYKVV RYDELKARCR PCECGANHIR LYPATLNVTE QLRTDHQMLS CLRTDYESSD ED. It is sometimes possible for the material contained within the vial of "E1B protein, large T-antigen, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.