Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Envelope small membrane protein (E) Recombinant Protein | E recombinant protein

Recombinant Bovine coronavirus Envelope small membrane protein (E)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Envelope small membrane protein (E); Recombinant Bovine coronavirus Envelope small membrane protein (E); Recombinant Envelope small membrane protein (E); Envelope small membrane protein; E protein; sM protein; E recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-84
Sequence
MFMADAYFADTVWYVGQIIFIVAICLLVIIVVVAFLATFKLCIQLCGMCNTLVLSPSIYVFNRGRQFYEFYNDVKPPVLDVDDV
Sequence Length
84
Species
Bovine coronavirus (strain OK-0514) (BCoV) (BCV)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
9,584 Da
NCBI Official Full Name
small membrane protein
NCBI Official Symbol
E
NCBI Protein Information
small membrane protein
UniProt Protein Name
Envelope small membrane protein
UniProt Gene Name
E
UniProt Synonym Gene Names
sM; E protein; sM protein
UniProt Entry Name
VEMP_CVBOK

Uniprot Description

Function: Component of the viral envelope that plays a central role in virus morphogenesis and assembly. It is sufficient to form virus-like particles. Seems to be important for creating the membrane curvature needed to acquire the rounded, stable and infectious particle phenotype. Acts as a viroporin, inducing the formation of hydrophilic pores in cellular membranes. Also induces apoptosis

By similarity.

Subunit structure: Homooligomer. Interacts with the M membrane protein in the budding compartment of the host cell, which is located between endoplasmic reticulum and the Golgi complex

By similarity.

Subcellular location: Virion membrane; Single-pass type III membrane protein

Potential. Host Golgi apparatus membrane; Single-pass type III membrane protein

Potential. Note: Largely membrane-embedded. The N-terminus could be located within the membrane near the cytoplasmic side since no part of the protein is aparently exposed on the virion outside. The large hydrophobic domain could form a hairpin, looping back through the membrane. There also may be a second hydrophobic domain integrated into membranes

By similarity.

Sequence similarities: Belongs to the coronaviruses E protein family.

Research Articles on E

Similar Products

Product Notes

The E e (Catalog #AAA1162120) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-84. The amino acid sequence is listed below: MFMADAYFAD TVWYVGQIIF IVAICLLVII VVVAFLATFK LCIQLCGMCN TLVLSPSIYV FNRGRQFYEF YNDVKPPVLD VDDV. It is sometimes possible for the material contained within the vial of "Envelope small membrane protein (E), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.