Hepatitis B Surface Antigen preS1 Protein
Recombinant Hepatitis B Surface Antigen preS1 (rHBsAg-preS1)
Applications
ELISA
Purity
>95% by SDS-PAGE and HPLC analyses.
Synonyms
Hepatitis B Surface Antigen preS1; Recombinant Hepatitis B Surface Antigen preS1 (rHBsAg-preS1); rHBsAg-preS1; Hepatitis B Surface Antigen preS1 protein
Host
E Coli
Purity/Purification
>95% by SDS-PAGE and HPLC analyses.
Form/Format
Lyophilized from a 0.2um filtered concentrated (1mg/ml) soluditon in 20mM PB, pH7.4, 50mM NaCl.
Physical Appearance: Sterile Filtered White lyohplized (freeze-dried) powder.
Physical Appearance: Sterile Filtered White lyohplized (freeze-dried) powder.
Sequence
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEAHQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQA
Applicable Applications for Hepatitis B Surface Antigen preS1 protein
1. Immunochromatography (capture and conjugate)
2. Preparing monoclonal or polyclonal antibodies for HBsAg-preS1
3. ELISA
2. Preparing monoclonal or polyclonal antibodies for HBsAg-preS1
3. ELISA
Endotoxin Level
Less than 1EU/ug of rHBsAg-preS1 as determined by LAL method.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20 degree C. Further dilutions should be made in appropriate buffered solutions.
Preparation and Storage
This lyophilized preparation is stable at 2-8 degree C, but should be kept at -20 degree C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 degree C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70 degree C. Avoid repeated freeze/thaw cycles.
Related Product Information for Hepatitis B Surface Antigen preS1 protein
Hepatitis B virus (HBV) is a human pathogen, causing serious liver disease. The HBV surface protein antigens (HBsAg) are comprised of three carboxyl co terminal HBs proteins termed large (LHBs), middle (MHBs) and small (SHBs, also called major) protein. LHBs and MHBs also share the highly hydrophobic, repetitive, membrane spanning S domain. In addition, LHBs has a 119 amino acid region called preS1.
Similar Products
Product Notes
The Hepatitis B Surface Antigen preS1 (Catalog #AAA546028) is a Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Hepatitis B Surface Antigen preS1 can be used in a range of immunoassay formats including, but not limited to, 1. Immunochromatography (capture and conjugate) 2. Preparing monoclonal or polyclonal antibodies for HBsAg-preS1 3. ELISA. Researchers should empirically determine the suitability of the Hepatitis B Surface Antigen preS1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MGGWSSKPRQ GMGTNLSVPN PLGFFPDHQL DPAFGANSNN PDWDFNPNKD HWPEAHQVGA GAFGPGFTPP HGGLLGWSPQ AQGILTTVPV APPPASTNRQ SGRQPTPISP PLRDSHPQA. It is sometimes possible for the material contained within the vial of "Hepatitis B Surface Antigen preS1, Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
