Prolactin Active Protein | Prl R active protein

Recombinant Human Prolactin Receptor

Cat. Num. AAA143283

• Gene Names: PRLR; HPRL; MFAB; hPRLrI
• Purity: Greater than 97.0% as determined by: (a) Analysis by SEC-HPLC. (b) Analysis by SDS-PAGE. (c) Gel filtration at pH 8 under non denaturative conditions.
• Synonyms: Prolactin; Recombinant Human Prolactin Receptor; PRL R Human; Prolactin Soluble Receptor Human Recombinant; PRL-R; hPRLrI; Prl R active protein

• Host: E Coli
• Purity/Purification: Greater than 97.0% as determined by: (a) Analysis by SEC-HPLC. (b) Analysis by SDS-PAGE. (c) Gel filtration at pH 8 under non denaturative conditions.
• Form/Format: The Prolactin Receptor was lyophilized from a concentrated (0.4mg/ml) solution with 0.0045mM NaHCO3.; Sterile filtered white lyophilized powder.
• Sequence: AGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNYSLTYHREGETLMHECPDYITGGPNSCHFGKQYTSMWRTYIMMVNATNQMGSSFSDELYVDVTYIVQPDPPLELAVEVKQPEDRKPYLWIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEWEIHFAGQQTEFKILSLHPGQKYLVQVRCKPDHGYWSAWSPATFIQIPSDFTMNDTTVW
• Sequence Length: 622

• Solubility: It is recommended to reconstitute the lyophilized PRLR in sterile 18M-cm H2O not less than 100 ug/ml and not more than 1 mg/ml, which can then be further diluted to other aqueous solutions.
• Protein Content: UV spectroscopy at 280 nm using the absorbency value of 2.63 as the extinction coefficient for a 0.1% (1mg/ml) solution. This value is calculated by the PC GENE computer analysis program of protein sequences (IntelliGenetics).
• Biological Activity: Activity is determined by the dose-dependant inhibition of Prolactin stimuled proliferation of Nb2 cells and by high affinity binding of ovine Prolactin and other lactogenic hormones in 1:1 molar ratio.
• Preparation and Storage: Lyophilized PRL-R although stable at room temperature for 1-2 weeks, should be stored desiccated below -18 degree C or preferably even at -80 degree C to prevent dimer formation. Upon reconstitution PRL-R should be stored sterile at 4 degree C between 2-7 days and for future use below -18 degree C. For long term storage at 4 degree C it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles as they cause oligomerization of the protein.

Related Product Information for Prl R active protein

Description: Extra Cellular Domain Prolactin Receptor Human Recombinant produced in E Coli is a non-glycosylated, Polypeptide chain containsing 210 amino acids and having a molecular mass of 23.97 kDa. The Prolactin Receptor is purified by proprietary chromatographic techniques according to Bignon et al. (1994) JBC 269; 3318-24 and tested according to Gertler et al. (1996) JBC 271; 24482-91.

Introduction: Prolactin is a pituitary hormone that plays a role in the stimulation of milk production, salt and water regulation, growth, development and reproduction. The primary step in its action is the binding to a specific membrane receptor (prolactin receptor) which belongs to the superfamily of class 1 cytokine receptors. Prolactin is a hormone involved in a range of significant functions including ion transport and osmoregulation, stimulation of milk, protein synthesis as well as the regulation of numerous reproductive functions. Prolactin exerts its influence on different cell types through a signal transduction pathway which begins with the binding of the hormone to a transmembrane Prolactin receptor. PRLR varies in size (short and long forms) with tissue source and species, from ~40 kDa to 100 kDa. The PRL-R consists of at least 3 separate domains: an extracellular region with 5 cysteines which contains the prolactin binding site, a single transmembrane domain and a cytoplasmic region, the length of which appears to influence ligand binding and regulate cellular function.

Product Categories/Family for Prl R active protein

Cytokines and Growth Factors; Growth Factors; Prolactin

NCBI and Uniprot Product Information

• NCBI GI #: 4506107
• NCBI GeneID: 5618
• NCBI Accession #: NP_000940.1
• NCBI GenBank Nucleotide #: NM_000949.6
• UniProt Accession #: P16471; Q16354; Q8TD75; Q8TD78; Q96P35; Q96P36; Q9BX87; Q9UHJ5; B2R882; D1MDP1
• Molecular Weight: 35,011 Da
• NCBI Official Full Name: prolactin receptor isoform 1
• NCBI Official Synonym Full Names: prolactin receptor
• NCBI Official Symbol: PRLR
• NCBI Official Synonym Symbols: HPRL; MFAB; hPRLrI
• NCBI Protein Information: prolactin receptor; hPRL receptor; secreted prolactin binding protein
• UniProt Protein Name: Prolactin receptor
• Protein Family: Prolactin
• UniProt Gene Name: PRLR
• UniProt Synonym Gene Names: PRL-R
• UniProt Entry Name: PRLR_HUMAN

NCBI Description

This gene encodes a receptor for the anterior pituitary hormone, prolactin, and belongs to the type I cytokine receptor family. Prolactin-dependent signaling occurs as the result of ligand-induced dimerization of the prolactin receptor. Several alternatively spliced transcript variants encoding different membrane-bound and soluble isoforms have been described for this gene, which may function to modulate the endocrine and autocrine effects of prolactin in normal tissue and cancer. [provided by RefSeq, Feb 2011]

Uniprot Description

PRLR: receptor for the anterior pituitary hormone prolactin and placental lactogen I and II. Interacts with Cyclophilin A, differentially regulating various signaling pathways from the PrlR. Prolactin signaling is attenuated by threonine and tyrosine phosphorylation. Two alternative splice isoforms have been identified.

Protein type: Receptor, cytokine; Membrane protein, integral

Chromosomal Location of Human Ortholog: 5p13.2

Cellular Component: cell surface; plasma membrane; integral to membrane; extracellular region

Molecular Function: protein binding; protein homodimerization activity; peptide hormone binding; ornithine decarboxylase activator activity; metal ion binding; prolactin receptor activity

Biological Process: lactation; regulation of cell adhesion; transmembrane receptor protein tyrosine kinase activation (dimerization); cell surface receptor linked signal transduction; T cell activation; regulation of epithelial cell differentiation; tyrosine phosphorylation of JAK2 protein; steroid biosynthetic process; embryo implantation; negative regulation of apoptosis

Disease: Multiple Fibroadenomas Of The Breast; Hyperprolactinemia