Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page ((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.)

Leukemia inhibitory factor (LIF)(Active) Active Protein | LIF active protein

Recombinant Human Leukemia inhibitory factor (LIF)(Active)

Gene Names
LIF; CDF; DIA; HILDA; MLPLI
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Leukemia inhibitory factor (LIF)(Active); Recombinant Human Leukemia inhibitory factor (LIF)(Active); LIF active protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
23-202aa, Full Length of Mature Protein
Sequence
SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF
Species
Homo sapiens (Human)
Endotoxin
Less than 1.0EU/ug as determined by LAL method.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized human LIF at 2ug/mL can bind human LIFR , the EC50 is 22.58-30.24ng/mL.
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

SDS-Page

((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.)

SDS-Page ((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.)

Activity

Activity
Product Categories/Family for LIF active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22,008 Da
NCBI Official Full Name
leukemia inhibitory factor isoform 1
NCBI Official Synonym Full Names
leukemia inhibitory factor
NCBI Official Symbol
LIF
NCBI Official Synonym Symbols
CDF; DIA; HILDA; MLPLI
NCBI Protein Information
leukemia inhibitory factor; D factor; human interleukin in DA cells; melanoma-derived LPL inhibitor; differentiation-inducing factor; hepatocyte-stimulating factor III; cholinergic differentiation factor; differentiation-stimulating factor; differentiatio
UniProt Protein Name
Leukemia inhibitory factor
UniProt Gene Name
LIF
UniProt Synonym Gene Names
HILDA; LIF; D factor; MLPLI
UniProt Entry Name
LIF_HUMAN

NCBI Description

The protein encoded by this gene is a pleiotropic cytokine with roles in several different systems. It is involved in the induction of hematopoietic differentiation in normal and myeloid leukemia cells, induction of neuronal cell differentiation, regulator of mesenchymal to epithelial conversion during kidney development, and may also have a role in immune tolerance at the maternal-fetal interface. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Mar 2012]

Uniprot Description

LIF: LIF has the capacity to induce terminal differentiation in leukemic cells. Its activities include the induction of hematopoietic differentiation in normal and myeloid leukemia cells, the induction of neuronal cell differentiation, and the stimulation of acute-phase protein synthesis in hepatocytes. Belongs to the LIF/OSM family.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 22q12.2

Cellular Component: extracellular space; cytoplasm

Molecular Function: growth factor activity; leukemia inhibitory factor receptor binding; cytokine activity; receptor binding

Biological Process: transcription from RNA polymerase II promoter; negative regulation of hormone secretion; multicellular organismal development; leukemia inhibitory factor signaling pathway; stem cell maintenance; tyrosine phosphorylation of Stat3 protein; decidualization; positive regulation of peptidyl-serine phosphorylation; positive regulation of tyrosine phosphorylation of Stat3 protein; negative regulation of cell proliferation; positive regulation of tyrosine phosphorylation of Stat1 protein; positive regulation of peptidyl-tyrosine phosphorylation; positive regulation of MAPKKK cascade; negative regulation of meiosis; positive regulation of cell proliferation; neuron development; blood vessel remodeling; positive regulation of transcription from RNA polymerase II promoter; immune response; positive regulation of macrophage differentiation; muscle morphogenesis; alveolus development; embryo implantation; positive regulation of peptidyl-serine phosphorylation of STAT protein; positive regulation of astrocyte differentiation

Research Articles on LIF

Similar Products

Product Notes

The LIF lif (Catalog #AAA9018407) is an Active Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 23-202aa, Full Length of Mature Protein. The amino acid sequence is listed below: SPLPITPVNA TCAIRHPCHN NLMNQIRSQL AQLNGSANAL FILYYTAQGE PFPNNLDKLC GPNVTDFPPF HANGTEKAKL VELYRIVVYL GTSLGNITRD QKILNPSALS LHSKLNATAD ILRGLLSNVL CRLCSKYHVG HVDVTYGPDT SGKDVFQKKK LGCQLLGKYK QIIAVLAQAF. It is sometimes possible for the material contained within the vial of "Leukemia inhibitory factor (LIF)(Active), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.