Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

I-TAC (CXCL11) active protein

Mouse I-TAC (CXCL11)

Gene Names
Cxcl11; Ip9; H174; Itac; b-R1; Cxc11; I-tac; Scyb11; Scyb9b; betaR1
Reactivity
Mouse
Purity
> 98% by SDS-PAGE and HPLC
Synonyms
I-TAC (CXCL11); Mouse I-TAC (CXCL11); Recombinant Murine I-TAC; I-TAC (CXCL11) active protein
Ordering
For Research Use Only!
Host
E Coli
Reactivity
Mouse
Purity/Purification
> 98% by SDS-PAGE and HPLC
Form/Format
Lyophilized
Sequence
FLMFKQGRCLCIGPGMKAVKMAEIEKASVIYPSNGCDKVEVIVTMKAHKR QRCLDPRSKQARLIMQAIEKKNFLRRQNM
Sequence Length
100
Endotoxin Level
< 0.1 ng per ug of I-TAC
Biological Activity
Determined by its ability to chemoattract murine CXCR3 transfected HEK/293 cells using a concentration range of 10.0-100.0 ng/ml.
Related Product Information for I-TAC (CXCL11) active protein
I-TAC is a "non-ELR" CXC chemokine that is regulated by interferon and signals through the CXCR3 receptor. I-TAC is chemoattractant for IL-2 activated T cells, but does not affect freshly isolated un-stimulated T cells, neutrophils, or monocytes. Recombinant murine I-TAC is a 9.0 kDa protein containing 79 amino acid residues including the four highly conserved cysteine residues present in CXC chemokines.
Product Categories/Family for I-TAC (CXCL11) active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
9.0 kDa
NCBI Official Full Name
C-X-C motif chemokine 11
NCBI Official Synonym Full Names
chemokine (C-X-C motif) ligand 11
NCBI Official Symbol
Cxcl11
NCBI Official Synonym Symbols
Ip9; H174; Itac; b-R1; Cxc11; I-tac; Scyb11; Scyb9b; betaR1
NCBI Protein Information
C-X-C motif chemokine 11; small-inducible cytokine B11; interferon-inducible T-cell alpha chemoattractant; small inducible cytokine subfamily B (Cys-X-Cys), member 11
UniProt Protein Name
C-X-C motif chemokine 11
UniProt Gene Name
Cxcl11
UniProt Synonym Gene Names
Scyb11; I-TAC
UniProt Entry Name
CXL11_MOUSE

Uniprot Description

Function: Chemotactic for interleukin-activated T-cells but not unstimulated T-cells, neutrophils or monocytes. Induces calcium release in activated T-cells. Binds to CXCR3. May play an important role in CNS diseases which involve T-cell recruitment. May play a role in skin immune responses

By similarity.

Subcellular location: Secreted.

Sequence similarities: Belongs to the intercrine alpha (chemokine CxC) family.

Research Articles on I-TAC (CXCL11)

Similar Products

Product Notes

The I-TAC (CXCL11) cxcl11 (Catalog #AAA692031) is an Active Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The Mouse I-TAC (CXCL11) reacts with Mouse and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: FLMFKQGRCL CIGPGMKAVK MAEIEKASVI YPSNGCDKVE VIVTMKAHKR QRCLDPRSKQ ARLIMQAIEK KNFLRRQNM. It is sometimes possible for the material contained within the vial of "I-TAC (CXCL11), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.