Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Macrophage Inflammatory protein-5 Active Protein | MIP 5 active protein

Recombinant Human Macrophage Inflammatory protein-5 (CCL15)

Gene Names
CCL15; LKN1; NCC3; SY15; HCC-2; LKN-1; MIP-5; NCC-3; SCYL3; MIP-1D; MRP-2B; SCYA15; HMRP-2B; MIP-1 delta
Purity
Greater than 97.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Synonyms
Macrophage Inflammatory protein-5; Recombinant Human Macrophage Inflammatory protein-5 (CCL15); MIP 5 Human; Macrophage Inflammatory Protein-5 Human Recombinant (CCL15); Small inducible cytokine A15 precursor; CCL15; Macrophage inflammatory protein 5; MIP-5; MIP5; Chemokine CC-2; HCC-2; NCC-3; MIP- 1 delta; Leukotactin-1; LKN-1; Mrp-2b; C-C motif chemokine 15; MIP 5 active protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Greater than 97.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Form/Format
MIP5 was lyophilized from a concentrated (1mg/ml) solution containing 20mM PBS pH-7.4 and 100mM NaCl.
Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence
QFINDAETELMMSKLPLENPVVLNSFHFAADCCTSYISQSIPCSLMKSYFETSSECSKP GVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI
Sequence Length
113
Solubility
It is recommended to reconstitute the lyophilized MIP5 in sterile 18M Omega -cm H2O not less than 100 ug/ml, which can then be further diluted to other aqueous solutions.
Biological Activity
Determined by its ability to chemoattract human T-lymphocytes using a concentration range of 1-10 ng/ml corresponding to a Specific Activity of 100,000-1,000,000IU/mg.
Preparation and Storage
Lyophilized MIP-5 although stable at room temperature for 3 weeks, should be stored desiccated below -18 degree C. Upon reconstitution CCL15 should be stored at 4 degree C between 2-7 days and for future use below -18 degree C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
Related Product Information for MIP 5 active protein
Description: Macrophage Inflammatory Protein-5 Human Recombinant produced in E Coli is a single, non-glycosylated, polypeptide chain containing 92 amino acids and having a molecular mass of 10.1 kDa. The MIP5 is purified by proprietary chromatographic techniques.

Introduction: CCL15, a new human CC chemokine, was isolated from a human fetal spleen cDNA library. CCL15 cDNA encodes a predicted 113 amino acid (aa) protein containing a putative signal peptide of 21 amino acids that is cleaved to generate a 92 aa residue mature protein. Within the CC family members, human CCL15 shares 45%, 44%, 35%, and 30% aa homology with mouse C10, human MPIF-1, human HCC-1, and mouse MIP-1, respectively. The gene for MIP-5 is found on chromosome 17 where the genes for most of the human CC chemokines are located. Human CCL15 is expressed in T and B lymphocytes, NK cells, monocytes and monocyte-derived dendritic cells. Human MIP-5 is chemotactic for T cells and monocytes and has been shown to induce calcium flux in human CCR-1-transfected cells.
Product Categories/Family for MIP 5 active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
12,248 Da
NCBI Official Full Name
C-C motif chemokine 15 preproprotein
NCBI Official Synonym Full Names
chemokine (C-C motif) ligand 15
NCBI Official Symbol
CCL15
NCBI Official Synonym Symbols
LKN1; NCC3; SY15; HCC-2; LKN-1; MIP-5; NCC-3; SCYL3; MIP-1D; MRP-2B; SCYA15; HMRP-2B; MIP-1 delta
NCBI Protein Information
C-C motif chemokine 15; chemokine CC-2; leukotactin 1; macrophage inflammatory protein 5; new CC chemokine 3; small inducible cytokine subfamily A (Cys-Cys), member 15; small-inducible cytokine A15
UniProt Protein Name
C-C motif chemokine 15
UniProt Gene Name
CCL15
UniProt Synonym Gene Names
MIP5; NCC3; SCYA15; HCC-2; LKN-1; MIP-5
UniProt Entry Name
CCL15_HUMAN

NCBI Description

This gene is located in a cluster of similar genes in the same region of chromosome 17. These genes encode CC cytokines, which are secreted proteins characterized by two adjacent cysteines. The product of this gene is chemotactic for T cells and monocytes, and acts through C-C chemokine receptor type 1 (CCR1). The proprotein is further processed into numerous smaller functional peptides. Naturally-occurring readthrough transcripts occur from this gene into the downstream gene, CCL14 (chemokine (C-C motif) ligand 14). [provided by RefSeq, Jan 2013]

Uniprot Description

CCL15: Chemotactic factor that attracts T-cells and monocytes, but not neutrophils, eosinophils, or B-cells. Acts mainly via CC chemokine receptor CCR1. Also binds to CCR3. CCL15(22-92), CCL15(25-92) and CCL15(29-92) are more potent chemoattractants than the small-inducible cytokine A15. Belongs to the intercrine beta (chemokine CC) family.

Protein type: Secreted, signal peptide; Secreted; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 17q12

Cellular Component: extracellular space

Molecular Function: heparin binding; chemokine activity; receptor binding; chemoattractant activity

Biological Process: cellular calcium ion homeostasis; cell-cell signaling; positive chemotaxis; immune response; signal transduction; chemotaxis

Research Articles on MIP 5

Similar Products

Product Notes

The MIP 5 ccl15 (Catalog #AAA143173) is an Active Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: QFINDAETEL MMSKLPLENP VVLNSFHFAA DCCTSYISQS IPCSLMKSYF ETSSECSKP GVIFLTKKGR QVCAKPSGPG VQDCMKKLKP YSI. It is sometimes possible for the material contained within the vial of "Macrophage Inflammatory protein-5, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.