IP-10 Active Protein | IP 10 active protein

Recombinant Human IP-10 (CXCL10)

Cat. Num. AAA142037

• Gene Names: CXCL10; C7; IFI10; INP10; IP-10; crg-2; mob-1; SCYB10; gIP-10
• Purity: Greater than 97.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
• Synonyms: IP-10; Recombinant Human IP-10 (CXCL10); IP 10 Human; IP-10 Human Recombinant (CXCL10); Small inducible cytokine B10; CXCL10; 10 kDa interferon-gamma-induced protein; Gamma-IP10; chemokine (C-X-C motif) ligand 10; C7; IFI10; INP10; crg-2; mob-1; SCYB10; gIP-10; IP 10 active protein

• Host: E Coli
• Purity/Purification: Greater than 97.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
• Form/Format: Lyophilized from a 0.2um filtered concentrated (0.5mg/ml) solution in 20mM PB, pH 7.4, 50mM NaCl.; Sterile Filtered White lyophilized (freeze-dried) powder.
• Sequence: VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKA IKNLLKAVSKEMSKRSP
• Sequence Length: 98

• Solubility: It is recommended to reconstitute the lyophilized IP-10 in sterile 18M Omega -cm H2O not less than 100 ug/ml, which can then be further diluted to other aqueous solutions.
• Biological Activity: Determined by its ability to chemoattract human T-Lymphocytes using a concentration range of 10-100ng/ml corresponding to a Specific Activity of 10,000-100,000IU/mg.
• Preparation and Storage: Lyophilized IP-10 although stable at room temperature for 3 weeks, should be stored desiccated below -18 degree C. Upon reconstitution CXCL10 should be stored at 4 degree C between 2-7 days and for future use below -18 degree C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.

Related Product Information for IP 10 active protein

Description: IP-10 Human Recombinant produced in E Coli is a single, non-glycosylated, polypeptide chain containing 77 amino acids and having a molecular mass of 8516 Dalton. The IP-10 is purified by proprietary chromatographic techniques.

Introduction: Chemokine (C-X-C motif) ligand 10 (CXCL10) is a small cytokine belonging to the CXC chemokine family that is also known as 10 kDa interferon-gamma-induced protein (?-IP10 or IP-10). CXCL10 is secreted by several cell types in response to IFN-?. These cell types include monocytes, endothelial cells and fibroblasts. CXCL10 has been attributed to several roles, such as chemoattraction for monocytes and T cells, promotion of T cell adhesion to endothelial cells, antitumor activity, and inhibition of bone marrow colony formation and angiogenesis. The gene for CXCL10 is located on human chromosome 4 in a cluster among several other CXC chemokines. This chemokine elicits its effects by binding to the cell surface chemokine receptor CXCR3. The three-dimensional crystal structure of this chemokine has been determined under 3 different conditions to a resolution of up to 1.92A.

Product Categories/Family for IP 10 active protein

Chemokines; IP-10 (CXCL10)

NCBI and Uniprot Product Information

• NCBI GI #: 149999382
• NCBI GeneID: 3627
• NCBI Accession #: NP_001556.2
• NCBI GenBank Nucleotide #: NM_001565.3
• UniProt Accession #: P02778; Q96QJ5
• Molecular Weight: 10,881 Da
• NCBI Official Full Name: C-X-C motif chemokine 10
• NCBI Official Synonym Full Names: chemokine (C-X-C motif) ligand 10
• NCBI Official Symbol: CXCL10
• NCBI Official Synonym Symbols: C7; IFI10; INP10; IP-10; crg-2; mob-1; SCYB10; gIP-10
• NCBI Protein Information: C-X-C motif chemokine 10; 10 kDa interferon gamma-induced protein; gamma IP10; gamma-IP10; interferon-inducible cytokine IP-10; protein 10 from interferon (gamma)-induced cell line; small inducible cytokine subfamily B (Cys-X-Cys), member 10; small-inducible cytokine B10
• UniProt Protein Name: C-X-C motif chemokine 10
• UniProt Gene Name: CXCL10
• UniProt Synonym Gene Names: INP10; SCYB10; Gamma-IP10; IP-10
• UniProt Entry Name: CXL10_HUMAN

NCBI Description

This antimicrobial gene encodes a chemokine of the CXC subfamily and ligand for the receptor CXCR3. Binding of this protein to CXCR3 results in pleiotropic effects, including stimulation of monocytes, natural killer and T-cell migration, and modulation of adhesion molecule expression. [provided by RefSeq, Sep 2014]

Uniprot Description

CXCL10: Chemotactic for monocytes and T-lymphocytes. Binds to CXCR3. Belongs to the intercrine alpha (chemokine CxC) family.

Protein type: Chemokine; Secreted, signal peptide; Motility/polarity/chemotaxis; Secreted

Chromosomal Location of Human Ortholog: 4q21

Cellular Component: extracellular space; extracellular region; external side of plasma membrane

Molecular Function: heparin binding; protein binding; CXCR3 chemokine receptor binding; chemokine activity; cAMP-dependent protein kinase regulator activity; receptor binding

Biological Process: muscle development; blood circulation; protein secretion; positive regulation of leukocyte chemotaxis; positive regulation of cAMP metabolic process; signal transduction; chemotaxis; regulation of cell proliferation; G-protein coupled receptor protein signaling pathway; negative regulation of angiogenesis; response to vitamin D; cell surface receptor linked signal transduction; cell-cell signaling; positive regulation of cell proliferation; response to gamma radiation; positive regulation of transcription from RNA polymerase II promoter; immune response; positive regulation of release of sequestered calcium ion into cytosol; response to cold; regulation of protein kinase activity; negative regulation of myoblast differentiation; inflammatory response; defense response to virus