IL-6 active protein

Human IL-6

Cat. Num. AAA691765

• Gene Names: IL6; HGF; HSF; BSF2; IL-6; IFNB2
• Reactivity: Human
• Purity: > 98% by SDS-PAGE & silver stain
• Synonyms: IL-6; Human IL-6; Recombinant Human Interleukin-6; CTL differentiation factor; B-cell stimulatory factor 2; Hybridoma growth factor; Interferon beta-2; IL-6 active protein

• Host: E Coli
• Reactivity: Human
• Purity/Purification: > 98% by SDS-PAGE & silver stain
• Form/Format: Lyophilized
• Sequence: MAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETC NKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITG LLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAI TTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALR QM
• Sequence Length: 186

• Endotoxin Level: < 0.1ng per ug of IL-6
• Buffer: PBS
• Length (aa): 186
• Result by N-terminal sequencing: MAPVPPGE
• Reconstitution: The lyophilized IL-6 hould be reconstituted in water to a concentration not less than 100 ug/ml. This solution can be diluted into other buffered solutions or stored at -20 °C for future use.
• Preparation and Storage: The lyophilized IL-6, though stable at room temperature, is best stored desiccated below 0 degree C. Reconstituted IL-6 should be stored in working aliquots at -20 degree C.

Testing Data

Testing Data #2

Related Product Information for IL-6 active protein

Interleukin 6 (IL-6) is a pleiotropic alpha-helical cytokine that plays important roles in acute phase reactions, inflammation, hematopoiesis, bone metabolism, and cancer progression. IL-6 activity is essential for the transition from acute inflammation to either acquired immunity or chronic inflammatory disease. It is secreted by multiple cell types as a 22 kDa-28 kDa phosphorylated and variably glycosylated molecule. Mature human IL6 is 183 amino acids (aa) in length and shares 41% aa sequence identity with mouse and rat IL-6. Alternate splicing generates several isoforms with internal deletions, some of which exhibit antagonistic properties. Human IL6 is equally active on mouse and rat cells. IL-6 induces signaling through a cell surface heterodimeric receptor complex composed of a ligand binding subunit (IL6 R) and a signal transducing subunit (gp130). IL-6 binds to IL-6 R, triggering IL-6 R association with gp130 and gp130 dimerization. Soluble forms of IL-6 R are generated by both alternate splicing and proteolytic cleavage. In a mechanism known as trans-signaling, complexes of soluble IL-6 and IL-6 R elicit responses from gp130expressing cells that lack cell surface IL-6 R. Trans-signaling enables a wider range of cell types to respond to IL-6, as the expression of gp130 is ubiquitous, while that of IL-6 R is predominantly restricted to hepatocytes, leukocytes, and lymphocytes. Soluble splice forms of gp130 block trans-signaling from IL-6/ IL-6 R but not from other cytokines that utilize gp130 as a co-receptor.

Product Categories/Family for IL-6 active protein

Cytokines & Growth Factors

References

1. Van Snick, J. (1990) Annu. Rev. Immunol. 8:253. 2. Hodge, D.R. et al. (2005) Eur. J. Cancer 41:2502. 3. Jones, S.A. (2005) J. Immunol. 175:3468. 4. RoseJohn, S. et al. (2006) J. Leukoc. Biol. 80:227. 5. Hirano, T. et al. (1986) Nature 324:73. 6. Alberti, L. et al. (2005) Cancer Res. 65:2. 7. Kestler, D.P. et al. (1995) Blood 86:4559. 8. Kestler, D.P. et al. (1999) Am. J. Hematol. 61:169. 9. Bihl, M.P. et al. (2002) Am. J. Respir. Cell Mol. Biol. 27:48. 10. Chiu, C.P. et al. (1988) Proc. Natl. Acad. Sci. 85:7099. 11. Murakami, M. et al. (1993) Science 260:1808.

NCBI and Uniprot Product Information

• NCBI GI #: 10834984
• NCBI GeneID: 3569
• NCBI Accession #: NP_00059
• NCBI GenBank Nucleotide #: NM_000600
• UniProt Accession #: P05321; Q9UCU2; Q9UCU3; Q9UCU4; P05231
• Molecular Weight: 21.1 kDa
• NCBI Official Full Name: interleukin-6
• NCBI Official Synonym Full Names: interleukin 6 (interferon, beta 2)
• NCBI Official Symbol: IL6
• NCBI Official Synonym Symbols: HGF; HSF; BSF2; IL-6; IFNB2
• NCBI Protein Information: interleukin-6; CDF; BSF-2; IFN-beta-2; interferon beta-2; interleukin BSF-2; hybridoma growth factor; CTL differentiation factor; B-cell stimulatory factor 2; B-cell differentiation factor
• UniProt Protein Name: Interleukin-6
• UniProt Gene Name: IL6
• UniProt Synonym Gene Names: IFNB2; IL-6; BSF-2; CDF; IFN-beta-2
• UniProt Entry Name: IL6_HUMAN

NCBI Description

This gene encodes a cytokine that functions in inflammation and the maturation of B cells. In addition, the encoded protein has been shown to be an endogenous pyrogen capable of inducing fever in people with autoimmune diseases or infections. The protein is primarily produced at sites of acute and chronic inflammation, where it is secreted into the serum and induces a transcriptional inflammatory response through interleukin 6 receptor, alpha. The functioning of this gene is implicated in a wide variety of inflammation-associated disease states, including suspectibility to diabetes mellitus and systemic juvenile rheumatoid arthritis. [provided by RefSeq, Jun 2011]

Uniprot Description

Function: Cytokine with a wide variety of biological functions. It is a potent inducer of the acute phase response. Plays an essential role in the final differentiation of B-cells into Ig-secreting cells Involved in lymphocyte and monocyte differentiation. It induces myeloma and plasmacytoma growth and induces nerve cells differentiation Acts on B-cells, T-cells, hepatocytes, hematopoietic progenitor cells and cells of the CNS. Also acts as a myokine. It is discharged into the bloodstream after muscle contraction and acts to increase the breakdown of fats and to improve insulin resistance.

Subcellular location: Secreted.

Post-translational modification: N- and O-glycosylated. Ref.14

Polymorphism: Genetic variations in IL6 may be correlated with bone mineral density (BMD). Low BMD is a risk factor for osteoporotic fracture. Osteoporosis is characterized by reduced bone mineral density, disrutption of bone microarchitecture, and the alteration of the amount and variety of non-collagenous proteins in bone. Osteoporotic bones are more at risk of fracture.

Involvement in disease: Rheumatoid arthritis systemic juvenile (RASJ) [MIM:604302]: An inflammatory articular disorder with systemic-onset beginning before the age of 16. It represents a subgroup of juvenile arthritis associated with severe extraarticular features and occasionally fatal complications. During active phases of the disorder, patients display a typical daily spiking fever, an evanescent macular rash, lymphadenopathy, hepatosplenomegaly, serositis, myalgia and arthritis.Note: Disease susceptibility is associated with variations affecting the gene represented in this entry.A IL6 promoter polymorphism is associated with a lifetime risk of development of Kaposi sarcoma in HIV-infected men.

Sequence similarities: Belongs to the IL-6 superfamily.