Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

BAFF active protein

Human BAFF

Gene Names
TNFSF13B; DTL; BAFF; BLYS; CD257; TALL1; THANK; ZTNF4; TALL-1; TNFSF20
Reactivity
Human
Purity
> 98% by SDS-PAGE & HPLC analyses
Synonyms
BAFF; Human BAFF; Recombinant Human BAFF; BAFF active protein
Ordering
For Research Use Only!
Host
E Coli
Reactivity
Human
Purity/Purification
> 98% by SDS-PAGE & HPLC analyses
Form/Format
Lyophilized
Sequence
AVQGPEETVTQDCLQLIADSETPTIQKGSYTFVPWLLSFKRGSALEEKEN KILVKETGYFFIYGQVLYTKTYAMGHLIQRKKVHVFGDELSLVTLFRCIQ NMPETLPNNSCYSAGIAKLEEGDELQLAIPRENAQISLDGDVTFFGALKL L
Sequence Length
266
Biological Activity
Determined by its dose-dependent stimulation of IL-8 production by human PBMC. The ED50 for this effect is less than 10ng/ml.
Related Product Information for BAFF active protein
BAFF, a member of the TNF family of ligands, is expressed in T cells, macrophages, monocytes and dendritic cells. BAFF is involved in stimulation of B and T cell function, and is an important survival and maturation factor for peripheral B cells. BAFF signals through three different TNF receptors TACI, BCMA and BAFF-R. The human BAFF gene codes for a 285 amino acid type II transmembrane protein containing a 46 amino acid cytoplasmic domain, a 21 amino acid transmembrane domain, and a 218 amino acid extracellular domain. Recombinant human soluble BAFF is a 153 amino acid polypeptide (17.0 kDa), which contains the TNF-like portion of the extracellular domain of BAFF.
Product Categories/Family for BAFF active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
31,223 Da
NCBI Official Full Name
tumor necrosis factor ligand superfamily member 13B isoform 2
NCBI Official Synonym Full Names
tumor necrosis factor (ligand) superfamily, member 13b
NCBI Official Symbol
TNFSF13B
NCBI Official Synonym Symbols
DTL; BAFF; BLYS; CD257; TALL1; THANK; ZTNF4; TALL-1; TNFSF20
NCBI Protein Information
tumor necrosis factor ligand superfamily member 13B; delta BAFF; Delta4 BAFF; B-lymphocyte stimulator; B-cell-activating factor; ApoL related ligand TALL-1; TNF homolog that activates apoptosis; dendritic cell-derived TNF-like molecule; tumor necrosis factor-like protein ZTNF4; TNF and ApoL-related leukocyte expressed ligand 1; tumor necrosis factor (ligand) superfamily, member 20
UniProt Protein Name
Tumor necrosis factor ligand superfamily member 13B
UniProt Gene Name
TNFSF13B
UniProt Synonym Gene Names
BAFF; BLYS; TALL1; TNFSF20; ZTNF4; BLyS; TALL-1
UniProt Entry Name
TN13B_HUMAN

NCBI Description

The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for receptors TNFRSF13B/TACI, TNFRSF17/BCMA, and TNFRSF13C/BAFFR. This cytokine is expressed in B cell lineage cells, and acts as a potent B cell activator. It has been also shown to play an important role in the proliferation and differentiation of B cells. Alternatively spliced transcript variants encoding distinct isoforms have been identified. [provided by RefSeq, Mar 2011]

Uniprot Description

Function: Cytokine that binds to TNFRSF13B/TACI and TNFRSF17/BCMA. TNFSF13/APRIL binds to the same 2 receptors. Together, they form a 2 ligands -2 receptors pathway involved in the stimulation of B- and T-cell function and the regulation of humoral immunity. A third B-cell specific BAFF-receptor (BAFFR/BR3) promotes the survival of mature B-cells and the B-cell response. Ref.5 Ref.16Isoform 2 seems to inhibit isoform 1 secretion and bioactivity

By similarity. Ref.5 Ref.16Isoform 3:Acts as a transcription factor for its own parent gene, in association with NF-kappa-B p50 subunit, at least in autoimmune and proliferative B-cell diseases. The presence of Delta4BAFF is essential for soluble BAFF release by IFNG/IFN-gamma-stimulated monocytes and for B-cell survival. It can directly or indirectly regulate the differential expression of a large number of genes involved in the innate immune response and the regulation of apoptosis. Ref.5 Ref.16

Subunit structure: Homotrimer. Isoform 2 heteromultimerizes with isoform 1, probably limiting the amount of functional isoform 1 on the cell surface. Isoform 3 is unlikely form trimers or bind to BAFF receptors. Ref.4 Ref.5

Subcellular location: Cell membrane; Single-pass type II membrane protein. Tumor necrosis factor ligand superfamily member 13b, soluble form: Secreted.

Tissue specificity: Abundantly expressed in peripheral blood Leukocytes and is specifically expressed in monocytes and macrophages. Also found in the spleen, lymph node, bone marrow, T-cells and dendritic cells. A lower expression seen in placenta, heart, lung, fetal liver, thymus, and pancreas. Isoform 2 is expressed in many myeloid cell lines. Ref.4

Induction: Up-regulated by exposure to IFNG/IFN-gamma. Down-regulated by phorbol myristate acetate/ionomycin treatment.

Post-translational modification: The soluble form derives from the membrane form by proteolytic processing.Isoform 2 is not efficiently shed from the membrane unlike isoform 1

By similarity.N-glycosylated.

Sequence similarities: Belongs to the tumor necrosis factor family.

Research Articles on BAFF

Similar Products

Product Notes

The BAFF tnfsf13b (Catalog #AAA691816) is an Active Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The Human BAFF reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: AVQGPEETVT QDCLQLIADS ETPTIQKGSY TFVPWLLSFK RGSALEEKEN KILVKETGYF FIYGQVLYTK TYAMGHLIQR KKVHVFGDEL SLVTLFRCIQ NMPETLPNNS CYSAGIAKLE EGDELQLAIP RENAQISLDG DVTFFGALKL L. It is sometimes possible for the material contained within the vial of "BAFF, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.