Fibroblast Growth Factor-23 Active Protein | FGF 23 active protein

Recombinant Human Fibroblast Growth Factor-23 His Tag

Cat. Num. AAA142251

• Gene Names: FGF23; ADHR; FGFN; HYPF; HPDR2; PHPTC
• Purity: Greater than 90.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
• Synonyms: Fibroblast Growth Factor-23; Recombinant Human Fibroblast Growth Factor-23 His Tag; FGF 23 Human; His; Fibroblast Growth Factor-23 Human Recombinant; His Tag; Tumor-derived hypophosphatemia-inducing factor; HYPF; ADHR; HPDR2; PHPTC; FGF23; FGF-23; FGF 23 His; FGF 23 active protein

• Host: E Coli
• Purity/Purification: Greater than 90.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
• Form/Format: The protein (0.5mg/ml) was lyophilized from 25mM Tris pH7.5 and 0.6M NaCl solution.; Sterile Filtered white lyophilized powder.
• Sequence: MLGARLRLWVCALCSVCSMSVLRAYPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTRSAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFIHHHHHH
• Sequence Length: 251

• Solubility: It is recommended to reconstitute the lyophilized Fibroblast Growth Factor-23 in sterile 18M Omega -cm H2O not less than 100 ug/ml, which can then be further diluted to other aqueous solutions.
• Biological Activity: Treatment with hrFGF23 has been shown to induce FGFR mediated Erk phosphorylation, reduce plasma PTH levels in rats and to reduce blood phosphate levels.
• Preparation and Storage: Lyophilized Fibroblast Growth Factor 23 although stable at room temperature for 3 weeks, should be stored desiccated below -18 degree C. Upon reconstitution FGF-23 should be stored at 4 degree C between 2-7 days and for future use below -18 degree C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.

Related Product Information for FGF 23 active protein

Description: Fibroblast Growth Factor-23 Human Recombinant produced in E Coli is a single, non-glycosylated polypeptide chain expressed with a -6xHis tag containing a total of 257 amino acids (251 a.a. FGF23+ 6 a.a. His tag) and having a molecular mass of 28629.5 Dalton. The FGF-23 is and purified by chromatographic techniques.

Introduction: FGF-23 is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities and are involved in a variety of biological processes including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. FGF-23 inhibits renal tubular phosphate transport. This gene was identified by its mutations associated with autosomal dominant hypophosphatemic rickets (ADHR), an inherited phosphate wasting disorder. Abnormally high level expression of FGF23 was found in oncogenic hypophosphatemic osteomalacia (OHO), a phenotypically similar disease caused by abnormal phosphate metabolism. Mutations FGF23 have also been shown to cause familial tumoral calcinosis with hyperphosphatemia.

Product Categories/Family for FGF 23 active protein

Cytokines and Growth Factors; Growth Factors; Fibroblast Growth Factor

NCBI and Uniprot Product Information

• NCBI GI #: 10190674
• NCBI GeneID: 8074
• NCBI Accession #: NP_065689.1
• NCBI GenBank Nucleotide #: NM_020638.2
• UniProt Accession #: Q9GZV9; Q4V758
• Molecular Weight: 27,954 Da
• NCBI Official Full Name: fibroblast growth factor 23
• NCBI Official Synonym Full Names: fibroblast growth factor 23
• NCBI Official Symbol: FGF23
• NCBI Official Synonym Symbols: ADHR; FGFN; HYPF; HPDR2; PHPTC
• NCBI Protein Information: fibroblast growth factor 23; phosphatonin; tumor-derived hypophosphatemia inducing factor
• UniProt Protein Name: Fibroblast growth factor 23
• UniProt Gene Name: FGF23
• UniProt Synonym Gene Names: HYPF; FGF-23
• UniProt Entry Name: FGF23_HUMAN

NCBI Description

This gene encodes a member of the fibroblast growth factor family of proteins, which possess broad mitogenic and cell survival activities and are involved in a variety of biological processes. The product of this gene regulates phosphate homeostasis and transport in the kidney. The full-length, functional protein may be deactivated via cleavage into N-terminal and C-terminal chains. Mutation of this cleavage site causes autosomal dominant hypophosphatemic rickets (ADHR). Mutations in this gene are also associated with hyperphosphatemic familial tumoral calcinosis (HFTC). [provided by RefSeq, Feb 2013]

Uniprot Description

FGF23: Regulator of phosphate homeostasis. Inhibits renal tubular phosphate transport by reducing SLC34A1 levels. Upregulates EGR1 expression in the presence of KL. Acts directly on the parathyroid to decrease PTH secretion. Regulator of vitamin-D metabolism. Negatively regulates osteoblast differentiation and matrix mineralization. Defects in FGF23 are the cause of autosomal dominant hypophosphataemic rickets (ADHR). ADHR is characterized by low serum phosphorus concentrations, rickets, osteomalacia, leg deformities, short stature, bone pain and dental abscesses. Defects in FGF23 are a cause of hyperphosphatemic familial tumoral calcinosis (HFTC). HFTC is a severe autosomal recessive metabolic disorder that manifests with hyperphosphatemia and massive calcium deposits in the skin and subcutaneous tissues. Belongs to the heparin-binding growth factors family.

Protein type: Secreted, signal peptide; Cytokine; Secreted

Chromosomal Location of Human Ortholog: 12p13.3

Cellular Component: extracellular space; extracellular region

Molecular Function: growth factor activity; type 1 fibroblast growth factor receptor binding

Biological Process: epidermal growth factor receptor signaling pathway; negative regulation of bone mineralization; cellular phosphate ion homeostasis; phosphoinositide-mediated signaling; fibroblast growth factor receptor signaling pathway; nerve growth factor receptor signaling pathway; negative regulation of hormone secretion; positive regulation of transcription, DNA-dependent; insulin receptor signaling pathway; innate immune response; negative regulation of osteoblast differentiation; phosphate ion homeostasis; cell differentiation; phosphate metabolic process; vitamin D catabolic process

Disease: Hypophosphatemic Rickets, Autosomal Dominant