Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Cholecystokinin Protein | CCK protein

Cholecystokinin

Applications
ELISA, Western Blot
Purity
>95% by SDS-PAGE
Synonyms
Cholecystokinin; CCK protein
Ordering
Host
E Coli
Purity/Purification
>95% by SDS-PAGE
Form/Format
Liquid
Sequence
CKAPSGRMSIVKNLQNLDPSHRISDRDYMGWMDF
Sequence Length
115
Applicable Applications for CCK protein
ELISA (EIA), Western Blot (WB), Affinity Purification (AP), Protein Array
Tags
His
Storage Buffer
50mM NaH2PO4, 500mM NaCl Buffer with 500mM Imidazole,10%glycerol(PH8.0)
Preparation and Storage
Store at -20 degree C.
Avoid repeated freezing and thawing.
Product Categories/Family for CCK protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
885
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
12,669 Da
NCBI Official Full Name
cholecystokinin preproprotein
NCBI Official Synonym Full Names
cholecystokinin
NCBI Official Symbol
CCK
NCBI Protein Information
cholecystokinin
UniProt Protein Name
Cholecystokinin
Protein Family
UniProt Gene Name
CCK
UniProt Synonym Gene Names
CCK; CCK58; CCK39; CCK33; CCK25; CCK18; CCK12; CCK8; CCK7; CCK5

NCBI Description

This gene encodes a member of the gastrin/cholecystokinin family of proteins. The encoded preproprotein is proteolytically processed to generate multiple protein products, including the peptide hormones cholecystokinin-8, -12, -33, and others. The encoded peptides have been shown to regulate gastric acid secretion and food intake. A sulfated form of cholecystokinin-8 may modulate neuronal activity in the brain. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2015]

Uniprot Description

This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear. Binding to CCK-A receptors stimulates amylase release from the pancreas, binding to CCK-B receptors stimulates gastric acid secretion.

Research Articles on CCK

Similar Products

Product Notes

The CCK cck (Catalog #AAA2888828) is a Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Cholecystokinin can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB), Affinity Purification (AP), Protein Array. Researchers should empirically determine the suitability of the CCK cck for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: CKAPSGRMSI VKNLQNLDPS HRISDRDYMG WMDF. It is sometimes possible for the material contained within the vial of "Cholecystokinin, Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.