BCA-1/ BLC Active Protein | BCA 1 active protein

Recombinant Human BCA-1/ BLC (CXCL13)

Cat. Num. AAA143270

• Gene Names: CXCL13; BLC; BCA1; ANGIE; BCA-1; BLR1L; ANGIE2; SCYB13
• Purity: Greater than 97.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
• Synonyms: BCA-1/ BLC; Recombinant Human BCA-1/ BLC (CXCL13); BCA 1 Human; BCA-1/BLC Human Recombinant (CXCL13); C-X-C motif chemokine 13; Small-inducible cytokine B13; B lymphocyte chemoattractant; CXC chemokine BLC; CXCL13; BCA1; BCA-1; CXCL-13; B cell Attracting Chemokine-1; BLC; ANGIE; BLR1L; SCYB13; ANGIE2; BCA 1 active protein

• Host: E Coli
• Purity/Purification: Greater than 97.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
• Form/Format: The BCA-1 protein was lyophilized from a concentrated (0.5mg/ml) solution containing 20mM PBS & 150mM NaCl pH-7.4.; Sterile Filtered White lyophilized (freeze-dried) powder.
• Sequence: VLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNG CPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKR SSSTLPVPVFKRKIP
• Sequence Length: 109

• Solubility: It is recommended to reconstitute the lyophilized CXCL13 in sterile 18M Omega -cm H2O not less than 100 ug/ml, which can then be further diluted to other aqueous solutions.
• Biological Activity: Determined by its ability to chemoattract human B cells using a concentration range of 1-10ng/ml corresponding to a Specific Activity of 100,000-1,000,000IU/mg.
• Preparation and Storage: Lyophilized BCA1 although stable at room temperature for 3 weeks, should be stored desiccated below -18 degree C. Upon reconstitution BCA1 should be stored at 4 degree C between 2-7 days and for future use below -18 degree C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.

Related Product Information for BCA 1 active protein

Description: CXCL13 Human Recombinant produced in E Coli is a single,non-glycosylated, polypeptide chain containing 87 amino acids and having a molecular mass of 10.3 kDa. The BCA-1 is purified by proprietary chromatographic techniques.

Introduction: BCA-1 is a CXC chemokine that is highly expressed in thesecondary lymphoid organs, such as follicles of the spleen, lymph nodes, and Peyer's patches. CXCL13 promotes the migration of B lymphocytes (compared to T cells and macrophages), by stimulating calcium influx into, and chemotaxis of, cells expressing Burkitt's lymphoma receptor 1 (BLR1). BCA1 therefore function in the homing of B lymphocytes to follicles. Human BCA-1 shares a 64% amino acid sequence similarity with the mouse protein and 23 - 34% amino acid sequence identity with other known CXC chemokines. Recombinant or chemically synthesized BCA1 is a potent chemoattractant for B lymphocytes but not T lymphocytes, monocytes or neutrophils. BLR1, a G protein-coupled receptor originally isolated from Burkitt's lymphoma cells, has now been shown to be the specific receptor for BCA1. Among cells of the hematopoietic lineages, the expression of BLR-1, now designated CXCR-5, is restricted to B lymphocytes and a subpopulation of T helper memory cells.

Product Categories/Family for BCA 1 active protein

Chemokines; BCA-1/BLC

NCBI and Uniprot Product Information

• NCBI GI #: 5453577
• NCBI GeneID: 10563
• NCBI Accession #: NP_006410.1
• NCBI GenBank Nucleotide #: NM_006419.2
• UniProt Accession #: O43927
• Molecular Weight: 12,664 Da
• NCBI Official Full Name: C-X-C motif chemokine 13
• NCBI Official Synonym Full Names: chemokine (C-X-C motif) ligand 13
• NCBI Official Symbol: CXCL13
• NCBI Official Synonym Symbols: BLC; BCA1; ANGIE; BCA-1; BLR1L; ANGIE2; SCYB13
• NCBI Protein Information: C-X-C motif chemokine 13; B-cell chemoattractant; B-cell-attracting chemokine 1; B-cell-homing chemokine (ligand for Burkitt's lymphoma receptor-1); B-lymphocyte chemoattractant; CXC chemokine BLC; b cell-attracting chemokine 1; b lymphocyte chemoattractant; chemokine (C-X-C motif) ligand 13 (B-cell chemoattractant); small inducible cytokine B subfamily (Cys-X-Cys motif), member 13 (B-cell chemoattractant); small-inducible cytokine B13
• UniProt Protein Name: C-X-C motif chemokine 13
• UniProt Gene Name: CXCL13
• UniProt Synonym Gene Names: BCA1; BLC; SCYB13; BCA-1
• UniProt Entry Name: CXL13_HUMAN

NCBI Description

B lymphocyte chemoattractant, independently cloned and named Angie, is an antimicrobial peptide and CXC chemokine strongly expressed in the follicles of the spleen, lymph nodes, and Peyer's patches. It preferentially promotes the migration of B lymphocytes (compared to T cells and macrophages), apparently by stimulating calcium influx into, and chemotaxis of, cells expressing Burkitt's lymphoma receptor 1 (BLR-1). It may therefore function in the homing of B lymphocytes to follicles. [provided by RefSeq, Oct 2014]

Uniprot Description

CXCL13: Chemotactic for B-lymphocytes but not for T-lymphocytes, monocytes and neutrophils. Does not induce calcium release in B- lymphocytes. Binds to BLR1/CXCR5. Belongs to the intercrine alpha (chemokine CxC) family.

Protein type: Secreted, signal peptide; Motility/polarity/chemotaxis; Secreted

Chromosomal Location of Human Ortholog: 4q21

Cellular Component: extracellular space; extracellular region

Molecular Function: heparin binding; fibroblast growth factor binding; CXCR3 chemokine receptor binding; chemokine activity; protein heterodimerization activity; CXCR5 chemokine receptor binding; CCR10 chemokine receptor binding; receptor agonist activity

Biological Process: chronic inflammatory response; lymphocyte chemotaxis across high endothelial venule; response to lipopolysaccharide; positive regulation of integrin activation; lymph node development; regulation of angiogenesis; positive regulation of cell-cell adhesion mediated by integrin; regulation of cell proliferation; G-protein coupled receptor protein signaling pathway; elevation of cytosolic calcium ion concentration; cell surface receptor linked signal transduction; cell-cell signaling; regulation of humoral immune response; defense response to bacterium; germinal center formation; immune response; inflammatory response