Tumor Necrosis Factor (TNF) Active Protein | TNF active protein

Recombinant Rabbit Tumor Necrosis Factor (TNF), Partial

Cat. Num. AAA7115102

• Gene Names: TNF; TNFA; TNFSF2; TNLG1F
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Tumor Necrosis Factor (TNF); Recombinant Rabbit Tumor Necrosis Factor (TNF); Partial; Tumor Necrosis Factor; Cachectin; TNF-Alpha; Tumor Necrosis Factor Ligand Superfamily Member 2; TNF-a; TNF; TNFA; TNFSF2; TNF active protein

• Host: E Coli
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized from a 0.2 mum Filtered 20 mM PB, 300 mM NaCl, pH 7.4
• Sequence Positions: 77-235aa; Partial
• Sequence: MVTLRSASRALSDKPLAHVVANPQVEGQLQWLSQRANALLANGMKLTDNQLVVPADGLYLIYSQVLFSGQGCRSYVLLTHTVSRFAVSYPNKVNLLSAIKSPCHRETPEEAEPMAWYEPIYLGGVFQLEKGDRLSTEVNQPEYLDLAESGQVYFGIIAL
• Sequence Length: 234

• Species: Rabbit
• Tag: Tag-Free
• Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
• Biological Activity: The ED50 as determined in a cytotoxicity assay using L-929 mouse fibroblast cells is less than 20 pg/ml in the presence of the metabolic inhibitor actinomycin D.
• Subcellular Location: Cell Membrane, Single-Pass Type II Membrane Protein, SUBCELLULAR LOCATION: Tumor necrosis factor, Membrane form: Membrane, Single-Pass Type II Membrane Protein, SUBCELLULAR LOCATION: Tumor necrosis factor, soluble form: Secreted, SUBCELLULAR LOCATION: C-domain 1: Secreted, SUBCELLULAR LOCATION: C-domain 2: Secreted
• Protein Families: Tumor Necrosis Factor Family
• Classification: Cytokine
• Subdivision: Tumor Necrosis Factor
• Preparation and Storage: Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Related Product Information for TNF active protein

Relevance: Tumor necrosis factor alpha (TNFalpha) is the prototypic ligand of the TNF superfamily. TNFalpha forms a homotrimer and functions by activating two types of receptors TNF-R1 (TNF receptor type 1, p55R) and TNF-R2 (TNF receptor type 2, p75R). TNFalpha is a pleiotropic cytokine that is capable to promote inflammation, to induce apoptotic cell death, and to inhibit tumorigenesis and viral replication. TNFalpha is a potent lymphoid factor that exerts cytotoxic effects on a wide range of tumor cells and certain other target cells.

Function: Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation.

Product Categories/Family for TNF active protein

Cancer

NCBI and Uniprot Product Information

• NCBI GI #: 126722916
• NCBI GeneID: 100009088
• NCBI Accession #: NP_001075732.1
• NCBI GenBank Nucleotide #: NM_001082263.1
• UniProt Accession #: P04924
• Molecular Weight: 17.59 kDa
• NCBI Official Full Name: tumor necrosis factor
• NCBI Official Symbol: TNF
• NCBI Official Synonym Symbols: TNFA; TNFSF2; TNLG1F
• NCBI Protein Information: tumor necrosis factor
• UniProt Protein Name: Tumor necrosis factor
• Protein Family: Tumor necrosis factor
• UniProt Gene Name: TNF
• UniProt Synonym Gene Names: TNFA; TNFSF2; TNF-a; NTF; ICD1; ICD2
• UniProt Entry Name: TNFA_RABIT

Uniprot Description

Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation.The TNF intracellular domain (ICD) form induces IL12 production in dendritic cells.