Thioredoxin (TXN) Active Protein | TXN active protein

Recombinant Human Thioredoxin (TXN)

Cat. Num. AAA7115151

• Gene Names: TXN; TRX; TRDX; TRX1
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Thioredoxin (TXN); Recombinant Human Thioredoxin (TXN); Thioredoxin; Trx; ATL-Derived Factor; ADF; Surface-Associated Sulphydryl Protein; SASP; TXN; TRDX; TRX; TRX1; TXN active protein

• Host: E Coli
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized from a 0.2 mum Filtered 20 mM PB, 150 mM NaCl, pH 7.2
• Sequence Positions: 1-105aa; Full Length
• Sequence: MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV
• Sequence Length: 85

• Species: Human
• Tag: N-terminal 6xHis-tagged
• Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
• Biological Activity: Specific activity as determined by the production of urea during the hydrolysis of arginine is greater than 0.1 Abs/min/mg.
• Subcellular Location: Nucleus, Cytoplasm, Secreted
• Protein Families: Thioredoxin Family
• Classification: Other Recombinant Protein
• Pathway: NOD-likereceptor Signaling Pathway
• Preparation and Storage: Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Related Product Information for TXN active protein

Relevance: Thioredoxin (TXN) is a member of the Thioredoxin family. Thioredoxin exists as a disulfide-linked homodimer and contains one Thioredoxin domain. Thioredoxin is up-regulated by ionizing radiation. Thioredoxin participates in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyzes dithiol-disulfide exchange reactions. Thioredoxin also plays a role in the reversible S-nitrosylation of cysteine residues in target proteins, and thereby contributes to the response to intracellular nitric oxide.

Function: Participates in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyzes dithiol-disulfide exchange reactions. Plays a role in the reversible S-nitrosylation of cysteine residues in target proteins, and thereby contributes to the response to intracellular nitric oxide. Nitrosylates the active site Cys of CASP3 in response to nitric oxide (NO), and thereby inhibits caspase-3 activity. Induces the FOS/JUN AP-1 DNA-binding activity in ionizing radiation (IR) cells through its oxidation/reduction status and stimulates AP-1 transcriptional activity.

Product Categories/Family for TXN active protein

Signal Transduction

NCBI and Uniprot Product Information

• NCBI GI #: 349732256
• NCBI GeneID: 7295
• NCBI Accession #: NP_001231867.1
• NCBI GenBank Nucleotide #: NM_001244938.1
• UniProt Accession #: P10599
• Molecular Weight: 13.9 kDa
• NCBI Official Full Name: thioredoxin isoform 2
• NCBI Official Synonym Full Names: thioredoxin
• NCBI Official Symbol: TXN
• NCBI Official Synonym Symbols: TRX; TRDX; TRX1
• NCBI Protein Information: thioredoxin
• UniProt Protein Name: Thioredoxin
• UniProt Gene Name: TXN
• UniProt Synonym Gene Names: TRDX; TRX; TRX1; Trx; ADF; SASP
• UniProt Entry Name: THIO_HUMAN

NCBI Description

The protein encoded by this gene acts as a homodimer and is involved in many redox reactions. The encoded protein is active in the reversible S-nitrosylation of cysteines in certain proteins, which is part of the response to intracellular nitric oxide. This protein is found in the cytoplasm. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011]