Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

TACI Active Protein | TNFRSF13B active protein

TACI, Recombinant, Human (Transmembrane activator and CAML interactor)

Gene Names
TNFRSF13B; CVID; RYZN; TACI; CD267; CVID2; TNFRSF14B
Purity
Highly Purified
98% by SDS-PAGE and HPLC analyses. Endotoxin: 0.1ng/ug (1EU/ug)
Synonyms
TACI; Recombinant; Human (Transmembrane activator and CAML interactor); TNFRSF13B active protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Highly Purified
98% by SDS-PAGE and HPLC analyses. Endotoxin: 0.1ng/ug (1EU/ug)
Form/Format
Supplied as a lyophilized powder from 10mM sodium citrate, pH 4.0, 150mM sodium chloride. Reconstitution: Reconstitute with ddH20 and a carrier protein to a concentration of 0.1-1mg/ml.
Sequence
MSGLGRSRRG GRSRVDQEER FPQGLWTGVAMRSCPEEQYWDPLLGTCMSC KTICNHQSQR TCAAFCRSLS CRKEQGKFYDHLLRDCISCA SICGQHPKQC AYFCENKLRS PVNLPPELRRQRSGEVENNS DNSGRYQGLEHRGSEASPALPGLKLSADQV
Biological Activity
Determined by its' ability to block human BAFF induced T2B cell survival using a concentration range of 1-3ug/ml.
Country of Origin
USA
Preparation and Storage
Lyophilized powder may be stored at -20 degree C. Reconstitute to nominal volume by adding ddH20 and a carrier protein. Aliquot and store at -20 degree C. Reconstituted product is stable for 3 months at -20 degree C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Related Product Information for TNFRSF13B active protein
Human TACI (Transmembrane activator and CAML interactor) is a newly discovered member of the TNF receptor superfamily. TACI is a receptor for BAFF (BlyS) and APRIL. Recombinant human TACI is a soluble 17.0kD protein containing 153 amino acid residues.
Product Categories/Family for TNFRSF13B active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
17.8kD
NCBI Official Full Name
tumor necrosis factor receptor superfamily member 13B
NCBI Official Synonym Full Names
tumor necrosis factor receptor superfamily, member 13B
NCBI Official Symbol
TNFRSF13B
NCBI Official Synonym Symbols
CVID; RYZN; TACI; CD267; CVID2; TNFRSF14B
NCBI Protein Information
tumor necrosis factor receptor superfamily member 13B; tumor necrosis factor receptor 13B; transmembrane activator and CAML interactor
UniProt Protein Name
Tumor necrosis factor receptor superfamily member 13B
UniProt Gene Name
TNFRSF13B
UniProt Synonym Gene Names
TACI
UniProt Entry Name
TR13B_HUMAN

NCBI Description

The protein encoded by this gene is a lymphocyte-specific member of the tumor necrosis factor (TNF) receptor superfamily. It interacts with calcium-modulator and cyclophilin ligand (CAML). The protein induces activation of the transcription factors NFAT, AP1, and NF-kappa-B and plays a crucial role in humoral immunity by interacting with a TNF ligand. This gene is located within the Smith-Magenis syndrome region on chromosome 17. [provided by RefSeq, Jul 2008]

Uniprot Description

Function: Receptor for TNFSF13/APRIL and TNFSF13B/TALL1/BAFF/BLYS that binds both ligands with similar high affinity. Mediates calcineurin-dependent activation of NF-AT, as well as activation of NF-kappa-B and AP-1. Involved in the stimulation of B- and T-cell function and the regulation of humoral immunity. Ref.6 Ref.7

Subunit structure: Binds TRAF2, TRAF5 and TRAF6. Binds the NH2-terminal domain of CAMLG with its C-terminus.

Subcellular location: Membrane; Single-pass type III membrane protein.

Tissue specificity: Highly expressed in spleen, thymus, small intestine and peripheral blood leukocytes. Expressed in resting B-cells and activated T-cells, but not in resting T-cells.

Involvement in disease: Immunodeficiency, common variable, 2 (CVID2) [MIM:240500]: A primary immunodeficiency characterized by antibody deficiency, hypogammaglobulinemia, recurrent bacterial infections and an inability to mount an antibody response to antigen. The defect results from a failure of B-cell differentiation and impaired secretion of immunoglobulins; the numbers of circulating B cells is usually in the normal range, but can be low.Note: The disease is caused by mutations affecting the gene represented in this entry. Ref.10Immunoglobulin A deficiency 2 (IGAD2) [MIM:609529]: Selective deficiency of immunoglobulin A (IGAD) is the most common form of primary immunodeficiency, with an incidence of approximately 1 in 600 individuals in the western world. Individuals with symptomatic IGAD often have deficiency of IgG subclasses or decreased antibody response to carbohydrate antigens such as pneumococcal polysaccharide vaccine. Individuals with IGAD also suffer from recurrent sinopulmonary and gastrointestinal infections and have an increased incidence of autoimmune disorders and of lymphoid and non-lymphoid malignancies. In vitro studies have suggested that some individuals with IGAD have impaired isotype class switching to IgA and others may have a post-switch defect. IGAD and CVID have been known to coexist in families. Some individuals initially present with IGAD1 and then develop CVID. These observations suggest that some cases of IGAD and CVID may have a common etiology.Note: The disease is caused by mutations affecting the gene represented in this entry. Ref.10

Sequence similarities: Contains 2 TNFR-Cys repeats.

Research Articles on TNFRSF13B

Similar Products

Product Notes

The TNFRSF13B tnfrsf13b (Catalog #AAA651054) is an Active Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: MSGLGRSRRG GRSRVDQEER FPQGLWTGVA MRSCPEEQYW DPLLGTCMSC KTICNHQSQR TCAAFCRSLS CRKEQGKFYD HLLRDCISCA SICGQHPKQC AYFCENKLRS PVNLPPELRR QRSGEVENNS DNSGRYQGLE HRGSEASPAL PGLKLSADQV. It is sometimes possible for the material contained within the vial of "TACI, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.