Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Pro-Neuregulin-1 (NRG1) Active Protein | NRG1 active protein

Recombinant Human Pro-Neuregulin-1, Membrane-Bound Isoform (NRG1), Partial

Gene Names
NRG1; GGF; HGL; HRG; NDF; ARIA; GGF2; HRG1; HRGA; SMDF; MST131; MSTP131; NRG1-IT2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Pro-Neuregulin-1 (NRG1); Recombinant Human Pro-Neuregulin-1; Membrane-Bound Isoform (NRG1); Partial; Pro-neuregulin-1; Neuregulin-1 beta 1; NRG1-beta 1; HRG1-beta 1; EGF; NRG1; GGF; HGL; HRGA; NDF; SMDF; NRG1 active protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized from a 0.2 mum Filtered 1xPBS, pH 7.4
Sequence Positions
177-241aa; Partial of Isoform 6
Sequence
SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKHLGIEFMEAE
Sequence Length
607
Species
Human
Tag
Tag-Free
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined in a serum-free cell proliferation assay using MCF-7 human breast cancer cells is less than 3 ng/mL.
Classification
Other Recombinant Protein
Preparation and Storage
Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for NRG1 active protein
neuregulin-1 (heregulin-1, NRG1) is a member of neuregulin family, which is comprised of four genes that encode a large number of secreted or membrane-bound isoforms. All family members share an EGF-like domain that interacts with the ErbB family of tyrosine kinase receptors. NRG1 isoforms can be classified into type I, type II and type III isoforms. NRG1 directs ligand for ERBB3 and ERBB4 tyrosine kinase receptors, concomitantly recruits ERBB1 and ERBB2 coreceptors, resulting in ligand-stimulated tyrosine phosphorylation and activation of the ERBB receptors. NRG proteins show distinct spatial and temporal expression patterns and play important roles during development of both the nervous system and the heart.
Product Categories/Family for NRG1 active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
7.5 kDa
NCBI Official Full Name
pro-neuregulin-1, membrane-bound isoform isoform HRG-beta1c
NCBI Official Synonym Full Names
neuregulin 1
NCBI Official Symbol
NRG1
NCBI Official Synonym Symbols
GGF; HGL; HRG; NDF; ARIA; GGF2; HRG1; HRGA; SMDF; MST131; MSTP131; NRG1-IT2
NCBI Protein Information
pro-neuregulin-1, membrane-bound isoform
UniProt Protein Name
Pro-neuregulin-1, membrane-bound isoform
Protein Family
UniProt Gene Name
NRG1
UniProt Synonym Gene Names
GGF; HGL; HRGA; NDF; SMDF; Pro-NRG1; ARIA; HRG
UniProt Entry Name
NRG1_HUMAN

NCBI Description

The protein encoded by this gene is a membrane glycoprotein that mediates cell-cell signaling and plays a critical role in the growth and development of multiple organ systems. An extraordinary variety of different isoforms are produced from this gene through alternative promoter usage and splicing. These isoforms are expressed in a tissue-specific manner and differ significantly in their structure, and are classified as types I, II, III, IV, V and VI. Dysregulation of this gene has been linked to diseases such as cancer, schizophrenia, and bipolar disorder (BPD). [provided by RefSeq, Apr 2016]

Uniprot Description

NRG1: Direct ligand for ERBB3 and ERBB4 tyrosine kinase receptors. Concomitantly recruits ERBB1 and ERBB2 coreceptors, resulting in ligand-stimulated tyrosine phosphorylation and activation of the ERBB receptors. The multiple isoforms perform diverse functions such as inducing growth and differentiation of epithelial, glial, neuronal, and skeletal muscle cells; inducing expression of acetylcholine receptor in synaptic vesicles during the formation of the neuromuscular junction; stimulating lobuloalveolar budding and milk production in the mammary gland and inducing differentiation of mammary tumor cells; stimulating Schwann cell proliferation; implication in the development of the myocardium such as trabeculation of the developing heart. Isoform 10 may play a role in motor and sensory neuron development. The cytoplasmic domain interacts with the LIM domain region of LIMK1. Interacts with ERBB3 and ERBB4. Type I isoforms are the predominant forms expressed in the endocardium. Isoform alpha is expressed in breast, ovary, testis, prostate, heart, skeletal muscle, lung, placenta liver, kidney, salivary gland, small intestine and brain, but not in uterus, stomach, pancreas, and spleen. Isoform 3 is the predominant form in mesenchymal cells and in non-neuronal organs, whereas isoform 6 is the major neuronal form. Isoform 8 is expressed in spinal cord and brain. Isoform 9 is the major form in skeletal muscle cells; in the nervous system it is expressed in spinal cord and brain. Also detected in adult heart, placenta, lung, liver, kidney, and pancreas. Isoform 10 is expressed in nervous system: spinal cord motor neurons, dorsal root ganglion neurons, and brain. Predominant isoform expressed in sensory and motor neurons. Not detected in adult heart, placenta, lung, liver, skeletal muscle, kidney, and pancreas. Not expressed in fetal lung, liver and kidney. Type IV isoforms are brain-specific. Belongs to the neuregulin family. 10 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Cell development/differentiation; Ligand, receptor tyrosine kinase; Motility/polarity/chemotaxis; Cytokine

Chromosomal Location of Human Ortholog: 8p12

Cellular Component: extracellular space; membrane; integral to plasma membrane; axon; apical plasma membrane; cytoplasm; extracellular region; nucleus; neuromuscular junction

Molecular Function: ErbB-2 class receptor binding; protein binding; transmembrane receptor protein tyrosine kinase activator activity; growth factor activity; ErbB-3 class receptor binding; transcription cofactor activity; cytokine activity; protein tyrosine kinase activator activity; receptor tyrosine kinase binding; receptor binding

Biological Process: regulation of protein heterodimerization activity; positive regulation of cell adhesion; transmembrane receptor protein tyrosine kinase activation (dimerization); neural crest cell development; cellular protein complex disassembly; nerve growth factor receptor signaling pathway; wound healing; cell morphogenesis; ventricular cardiac muscle cell differentiation; locomotory behavior; positive regulation of striated muscle cell differentiation; cardiac muscle cell differentiation; synaptogenesis; mammary gland development; cell communication; positive regulation of cardiac muscle cell proliferation; epidermal growth factor receptor signaling pathway; nervous system development; cell migration; fibroblast growth factor receptor signaling pathway; phosphoinositide-mediated signaling; neurotransmitter receptor metabolic process; regulation of protein homodimerization activity; MAPKKK cascade; neuron fate commitment; positive regulation of cell growth; peripheral nervous system development; positive regulation of protein kinase B signaling cascade; cell proliferation; embryonic development; glial cell fate commitment; innate immune response; negative regulation of secretion; positive regulation of Ras protein signal transduction; negative regulation of protein catabolic process; negative regulation of transcription, DNA-dependent; transmembrane receptor protein tyrosine kinase signaling pathway

Disease: Schizophrenia 6

Research Articles on NRG1

Similar Products

Product Notes

The NRG1 nrg1 (Catalog #AAA7115170) is an Active Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 177-241aa; Partial of Isoform 6. The amino acid sequence is listed below: SHLVKCAEKE KTFCVNGGEC FMVKDLSNPS RYLCKCPNEF TGDRCQNYVM ASFYKHLGIE FMEAE. It is sometimes possible for the material contained within the vial of "Pro-Neuregulin-1 (NRG1), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.