Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page

PPP1SS active protein

PPP1SS, human recombinant

Gene Names
PPP1CC; PP1C; PP-1G; PPP1G
Purity
>85% by SDS-PAGE
Synonyms
PPP1SS; human recombinant; Serine/threonine-protein phosphatase PP1-gamma catalytic subunit; PP1gamma; PPP1G; PPP1SS active protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
>85% by SDS-PAGE
Form/Format
Liquid. In 20mM Tris-HCl buffer (pH8.0) containing 50% glycerol, 0.2M NaCl, 2mM DTT
Sequence
MGSSHHHHHHSSGLVPRGSHMADLDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKKKPNATRPVTPPRGMITKQAKK
Gene Source
Human
Biological Activity
Specific activity > 700 units/mg
Measured by its ability to hydrolyze 1.0 nmole of p-nitrophenyl phosphate (pNPP) per minute at pH 7.5 at 37 degree C.
Preparation and Storage
Store at -20 degree C
Centrifuge the vial prior to opening.
Shelf life: ~12 months

SDS-Page

SDS-Page
Related Product Information for PPP1SS active protein
PPP1CC, also known as serine/threonine-protein phosphatase PP1-gamma catalytic subunit, is essential for cell division, and participates in the regulation of glycogen metabolism, muscle contractility and protein synthesis. This protein is involved in regulation of ionic conductances and long-term synaptic plasticity and may play an important role in dephosphorylating substrates such as the postsynaptic density-associated Ca2+/calmodulin dependent protein kinase II. Recombinant human PPP1CC protein, fused to His-tag at N-terminus, was expressed in E Coli and purified by using conventional chromatography. Serine/threonine-protein phosphatase PP1-gamma catalytic subunit
Product Categories/Family for PPP1SS active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
323
NCBI Official Full Name
Serine/threonine-protein phosphatase PP1-gamma catalytic subunit
NCBI Official Synonym Full Names
protein phosphatase 1, catalytic subunit, gamma isozyme
NCBI Official Symbol
PPP1CC
NCBI Official Synonym Symbols
PP1C; PP-1G; PPP1G
NCBI Protein Information
serine/threonine-protein phosphatase PP1-gamma catalytic subunit; serine/threonine phosphatase 1 gamma; protein phosphatase 1C catalytic subunit; protein phosphatase 1, catalytic subunit, gamma isoform
UniProt Protein Name
Serine/threonine-protein phosphatase PP1-gamma catalytic subunit
UniProt Gene Name
PPP1CC
UniProt Synonym Gene Names
PP-1G
UniProt Entry Name
PP1G_HUMAN

NCBI Description

The protein encoded by this gene belongs to the protein phosphatase family, PP1 subfamily. PP1 is an ubiquitous serine/threonine phosphatase that regulates many cellular processes, including cell division. It is expressed in mammalian cells as three closely related isoforms, alpha, beta/delta and gamma, which have distinct localization patterns. This gene encodes the gamma isozyme. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011]

Uniprot Description

PPP1CC: is a catalytic subunit of protein phosphatase 1 (PP1), a ubiquitous cytosolic serine-threonine phosphatase. Composed a catalytic subunit (PPP1CA, PPP1CB or PPP1CC) which is folded into its native form by inhibitor 2 and glycogen synthetase kinase 3, and then complexed to one or several targeting (or regulatory) subunits: PPP1R12A and PPP1R12B mediate binding to myosin; PPP1R3A, PPP1R3B, PPP1R3C and PPP1R3D mediate binding to glycogen; and PPP1R15A and PPP1R15B mediate binding to EIF2S1. PP1 is essential for cell division, plays critical roles in many cellular processes including glycogen metabolism, muscle contractility and protein synthesis, and is involved in the regulation of ionic conductances and long-term synaptic plasticity. Inhibits the synthesis of proteins involved in synaptic plasticity. Binds to the transcription factor cyclic AMP-dependent response element binding (CREB) and dephosphorylates it. May regulate chromatin condensation through regulation of histone H3 phosphorylation. Differentially expressed in gastric cancer. May participate in the neurodegenerative progress in Alzheimer's disease. Down-regulated in lung squamous cell carcinoma.

Protein type: EC 3.1.3.16; Motility/polarity/chemotaxis; Protein phosphatase, Ser/Thr (non-receptor); Nucleolus

Chromosomal Location of Human Ortholog: 12q24.1-q24.2

Cellular Component: focal adhesion; protein complex; mitochondrion; cytoplasm; nucleolus; nuclear speck; midbody; cytosol; nucleus; cleavage furrow

Molecular Function: protein binding; metal ion binding; phosphoric monoester hydrolase activity; protein serine/threonine phosphatase activity; phosphoprotein phosphatase activity; protein kinase binding

Biological Process: glycogen metabolic process; cell division; transforming growth factor beta receptor signaling pathway; triacylglycerol catabolic process; mitotic cell cycle; circadian regulation of gene expression; regulation of circadian rhythm; protein amino acid dephosphorylation; negative regulation of transforming growth factor beta receptor signaling pathway; entrainment of circadian clock by photoperiod

Research Articles on PPP1SS

Similar Products

Product Notes

The PPP1SS ppp1cc (Catalog #AAA849809) is an Active Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: MGSSHHHHHH SSGLVPRGSH MADLDKLNID SIIQRLLEVR GSKPGKNVQL QENEIRGLCL KSREIFLSQP ILLELEAPLK ICGDIHGQYY DLLRLFEYGG FPPESNYLFL GDYVDRGKQS LETICLLLAY KIKYPENFFL LRGNHECASI NRIYGFYDEC KRRYNIKLWK TFTDCFNCLP IAAIVDEKIF CCHGGLSPDL QSMEQIRRIM RPTDVPDQGL LCDLLWSDPD KDVLGWGEND RGVSFTFGAE VVAKFLHKHD LDLICRAHQV VEDGYEFFAK RQLVTLFSAP NYCGEFDNAG AMMSVDETLM CSFQILKPAE KKKPNATRPV TPPRGMITKQ AKK. It is sometimes possible for the material contained within the vial of "PPP1SS, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.