Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Platelet-Derived Growth Factor Subunit B (Pdgfb) Active Protein | Pdgfb active protein

Recombinant Mouse Platelet-Derived Growth Factor Subunit B (Pdgfb)

Gene Names
Pdgfb; Sis; c-sis; PDGF-2; PDGF-B
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Platelet-Derived Growth Factor Subunit B (Pdgfb); Recombinant Mouse Platelet-Derived Growth Factor Subunit B (Pdgfb); Platelet-Derived Growth Factor Subunit B; PDGF Subunit B; PDGF-2; Platelet-Derived Growth Factor B Chain; Platelet-Derived Growth Factor Beta Polypeptide; Proto-Oncogene c-Sis; Becaplermin; PDGFB; PDGF2; SIS; Pdgfb active protein
Ordering
For Research Use Only!
Host
E Coli
Specificity
Localized to vascular smooth muscle cells. Also weakly expressed by cortical interstitial cells but absent in tubules. Up-regulated in areas of renal fibrosis. In mice with unilateral ureteral obstruction, an increased expression in interstitial cells and in some tubules observed after day 4.
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized from a 0.2 mum Filtered 4 mM HCl
Sequence Positions
82-190aa; Full Length of Mature Protein
Sequence
SLGSLAAAEPAVIAECKTRTEVFQISRNLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRASQVQMRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETIVTPRPVT
Sequence Length
241
Species
Mouse
Tag
C-terminal 6xHis-tagged
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined in a cell proliferation assay using BALB/c 3T3 cells is less than 40 ng/ml.
Subcellular Location
Secreted
Protein Families
PDGF/VEGF Growth Factor Family
Classification
Cytokine
Subdivision
Growth Factor
Preparation and Storage
Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for Pdgfb active protein
Relevance: Platelet-Derived Growth Factor Subunit B (PDGFB) belongs to the PDGF/VEGF growth factor family. Platelet-derived growth factor is a potent mitogen for cells of mesenchymal origin. PDGFB can exist either as a homodimer (PDGF-BB) or as a heterodimer with the platelet-derived growth factor alpha polypeptide (PDGF-AB), where the dimers are connected by disulfide bonds. As growth factor, it plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. It is required for normal proliferation and recruitment of pericytes and vascular smooth muscle cells in the central nervous system, skin, lung, heart and placenta. PDGFB also plays an important role in wound healing.

Function: Growth factor that plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. Potent mitogen for cells of mesenchymal origin. Required for normal proliferation and recruitment of pericytes and vascular smooth muscle cells in the central nervous system, skin, lung, heart and placenta. Required for normal blood vessel development, and for normal development of kidney glomeruli. Plays an important role in wound healing. Signaling is modulated by the formation of heterodimers with PDGFA.
Product Categories/Family for Pdgfb active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
13.4 kDa
NCBI Official Full Name
platelet-derived growth factor subunit B
NCBI Official Synonym Full Names
platelet derived growth factor, B polypeptide
NCBI Official Symbol
Pdgfb
NCBI Official Synonym Symbols
Sis; c-sis; PDGF-2; PDGF-B
NCBI Protein Information
platelet-derived growth factor subunit B
UniProt Protein Name
Platelet-derived growth factor subunit B
UniProt Gene Name
Pdgfb
UniProt Synonym Gene Names
Sis; PDGF subunit B
UniProt Entry Name
PDGFB_MOUSE

Uniprot Description

PDGFB: Growth factor that plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. Potent mitogen for cells of mesenchymal origin. Required for normal proliferation and recruitment of pericytes and vascular smooth muscle cells in the central nervous system, skin, lung, heart and placenta. Required for normal blood vessel development, and for normal development of kidney glomeruli. Plays an important role in wound healing. Signaling is modulated by the formation of heterodimers with PDGFA. A chromosomal aberration involving PDGFB is found in dermatofibrosarcoma protuberans. Translocation t(17;22)(q22;q13) with PDGFB. Belongs to the PDGF/VEGF growth factor family.

Protein type: Secreted, signal peptide; Secreted; Motility/polarity/chemotaxis; Oncoprotein

Cellular Component: extracellular space; cell surface; membrane; basolateral plasma membrane; cytoplasm; extracellular region

Molecular Function: collagen binding; identical protein binding; protein homodimerization activity; growth factor activity; protein heterodimerization activity; platelet-derived growth factor binding; platelet-derived growth factor receptor binding; superoxide-generating NADPH oxidase activator activity; receptor binding; chemoattractant activity

Biological Process: embryonic placenta development; positive regulation of cyclin-dependent protein kinase activity; peptidyl-tyrosine phosphorylation; multicellular organismal development; heart development; positive regulation of transcription, DNA-dependent; positive regulation of smooth muscle cell proliferation; positive regulation of fibroblast growth factor receptor signaling pathway; platelet-derived growth factor receptor signaling pathway; cell projection biogenesis; positive regulation of smooth muscle cell migration; protein amino acid phosphorylation; positive regulation of MAP kinase activity; monocyte chemotaxis; positive regulation of fibroblast proliferation; positive chemotaxis; positive regulation of MAPKKK cascade; negative regulation of vasodilation; positive regulation of glomerular filtration; positive regulation of cell proliferation; response to wounding; positive regulation of mitotic cell cycle, embryonic; regulation of peptidyl-tyrosine phosphorylation; negative regulation of cell migration; substrate-bound cell migration; positive regulation of mitosis; positive regulation of chemotaxis; activation of protein kinase B; negative regulation of phosphatidylinositol biosynthetic process; positive regulation of blood vessel endothelial cell migration; positive regulation of phosphoinositide 3-kinase activity; positive regulation of protein amino acid autophosphorylation; positive regulation of phosphoinositide 3-kinase cascade; peptidyl-serine phosphorylation; positive regulation of peptidyl-tyrosine phosphorylation; positive regulation of cell division; activation of protein kinase activity; positive regulation of vasoconstriction; blood vessel morphogenesis; positive regulation of endothelial cell proliferation; blood coagulation; negative regulation of transcription, DNA-dependent; actin cytoskeleton organization and biogenesis; positive regulation of DNA replication; positive regulation of cell migration

Research Articles on Pdgfb

Similar Products

Product Notes

The Pdgfb pdgfb (Catalog #AAA7115011) is an Active Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 82-190aa; Full Length of Mature Protein. The amino acid sequence is listed below: SLGSLAAAEP AVIAECKTRT EVFQISRNLI DRTNANFLVW PPCVEVQRCS GCCNNRNVQC RASQVQMRPV QVRKIEIVRK KPIFKKATVT LEDHLACKCE TIVTPRPVT. It is sometimes possible for the material contained within the vial of "Platelet-Derived Growth Factor Subunit B (Pdgfb), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.