Malate Dehydrogenase (MDH1) Active Protein | MDH1 active protein

Recombinant Human Malate Dehydrogenase, Cytoplasmic (MDH1)

Cat. Num. AAA7115162

• Gene Names: MDH1; MDHA; MOR2; MDH-s; HEL-S-32; MGC:1375
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Malate Dehydrogenase (MDH1); Recombinant Human Malate Dehydrogenase; Cytoplasmic (MDH1); Malate Dehydrogenase Cytoplasmic; Cytosolic Malate Dehydrogenase; Diiodophenylpyruvate Reductase; MDH1; MDHA; MDH1 active protein

• Host: E Coli
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: 0.2 mum Filtered 20 mM Tris-HCl, 150 mM NaCl, pH 8.0
• Sequence Positions: 2-334aa; Full Length of Mature Protein
• Sequence: SEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLKDVIATDKEDVAFKDLDVAILVGSMPRREGMERKDLLKANVKIFKSQGAALDKYAKKSVKVIVVGNPANTNCLTASKSAPSIPKENFSCLTRLDHNRAKAQIALKLGVTANDVKNVIIWGNHSSTQYPDVNHAKVKLQGKEVGVYEALKDDSWLKGEFVTTVQQRGAAVIKARKLSSAMSAAKAICDHVRDIWFGTPEGEFVSMGVISDGNSYGVPDDLLYSFPVVIKNKTWKFVEGLPINDFSREKMDLTAKELTEEKESAFEFLSSA
• Sequence Length: 334

• Species: Human
• Tag: C-terminal 6xHis-tagged
• Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
• Biological Activity: Its dehydrogenation activity from (S)-malate to oxaloacetate in the presense of NAD+ is determined to be greater than 1000 pmol/min/ug
• Subcellular Location: Cytoplasm
• Protein Families: LDH/MDH Superfamily, MDH type 2 Family
• Classification: Other Recombinant Protein
• Preparation and Storage: Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Related Product Information for MDH1 active protein

Malate Dehydrogenase, Cytoplasmic (MDH1) is an enzyme which belongs to the MDH Type 2 sub-family of LDH/MDH superfamily. MDH1 is involved in the Citric Acid Cycle that catalyzes the conversion of Malate into Oxaloacetate (using NAD+) and vice versa. MDH1 should not be confused with Malic Enzyme, which catalyzes the conversion of Malate to Pyruvate, producing NADPH. MDH1 also participates in Gluconeogenesis, the synthesis of Glucose from smaller molecules. Pyruvate in the mitochondria is acted upon by Pyruvate Carboxylase to form Pxaloacetate, a Citric Acid Cycle intermediate. In order to transport the Oxaloacetate out of the Mitochondria, Malate Dehydrogenase reduces it to Malate, and it then traverses the inner Mitochondrial membrane. Once in the cytosol, the Malate is oxidized back to Oxaloacetate by MDH1. Finally, Phosphoenol-Pyruvate Carboxy Kinase (PEPCK) converts Oxaloacetate to Phosphoenol Pyruvate.

Product Categories/Family for MDH1 active protein

Signal Transduction

NCBI and Uniprot Product Information

• NCBI GI #: 1708967
• NCBI GeneID: 4190
• UniProt Accession #: P40925
• Molecular Weight: 37.5 kDa
• NCBI Official Full Name: Malate dehydrogenase, cytoplasmic
• NCBI Official Synonym Full Names: malate dehydrogenase 1
• NCBI Official Symbol: MDH1
• NCBI Official Synonym Symbols: MDHA; MOR2; MDH-s; HEL-S-32; MGC:1375
• NCBI Protein Information: malate dehydrogenase, cytoplasmic; malate dehydrogenase, peroxisomal
• UniProt Protein Name: Malate dehydrogenase, cytoplasmic
• Protein Family: Malate dehydrogenase
• UniProt Gene Name: MDH1
• UniProt Synonym Gene Names: MDHA
• UniProt Entry Name: MDHC_HUMAN

NCBI Description

This gene encodes an enzyme that catalyzes the NAD/NADH-dependent, reversible oxidation of malate to oxaloacetate in many metabolic pathways, including the citric acid cycle. Two main isozymes are known to exist in eukaryotic cells: one is found in the mitochondrial matrix and the other in the cytoplasm. This gene encodes the cytosolic isozyme, which plays a key role in the malate-aspartate shuttle that allows malate to pass through the mitochondrial membrane to be transformed into oxaloacetate for further cellular processes. Alternatively spliced transcript variants have been found for this gene. A recent study showed that a C-terminally extended isoform is produced by use of an alternative in-frame translation termination codon via a stop codon readthrough mechanism, and that this isoform is localized in the peroxisomes. Pseudogenes have been identified on chromosomes X and 6. [provided by RefSeq, Feb 2016]

Uniprot Description

MDH1: Malate dehydrogenase catalyzes the reversible oxidation of malate to oxaloacetate, utilizing the NAD/NADH cofactor system in the citric acid cycle. The protein encoded by this gene is localized to the cytoplasm and may play pivotal roles in the malate-aspartate shuttle that operates in the metabolic coordination between cytosol and mitochondria. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.[provided by RefSeq, Nov 2010]

Protein type: EC 1.1.1.96; Carbohydrate Metabolism - pyruvate; Oxidoreductase; Carbohydrate Metabolism - citrate (TCA) cycle; EC 1.1.1.37; Carbohydrate Metabolism - glyoxylate and dicarboxylate

Chromosomal Location of Human Ortholog: 2p13.3

Cellular Component: centrosome; extracellular space; mitochondrion; cytoplasm; cytosol

Molecular Function: malic enzyme activity; L-malate dehydrogenase activity; diiodophenylpyruvate reductase activity; NAD binding

Biological Process: malate metabolic process; oxaloacetate metabolic process; NADH metabolic process; tricarboxylic acid cycle; carbohydrate metabolic process; glucose metabolic process; cellular carbohydrate metabolic process; pathogenesis; gluconeogenesis