Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Interleukin-1 beta (Il1b) Active Protein | Il1b active protein

Recombinant Mouse Interleukin-1 beta (Il1b)

Gene Names
Il1b; Il-1b; IL-1beta
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Interleukin-1 beta (Il1b); Recombinant Mouse Interleukin-1 beta (Il1b); Interleukin-1 Beta; IL-1 Beta; Il1b; Il1b active protein
Ordering
For Research Use Only!
Host
E Coli
Specificity
Expressed in activated macrophages (at protein level).
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized from a 0.2 mum Filtered 50 mM Tris-HCl, 50 mM NaCl, pH 8.0
Sequence Positions
118-269aa; Full Length of Mature Protein
Sequence
VPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS
Sequence Length
269
Species
Mouse
Tag
Tag-Free
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined in a cell proliferation assay using mouse D10S cells is less than 20 pg/mL.
Subcellular Location
Cytoplasm, Cytosol, Lysosome, Secreted, Exosome, Cytoplasmic Vesicle, Autophagosome, Secreted
Protein Families
IL-1 Family
Classification
Cytokine
Subdivision
Interleukin
Preparation and Storage
Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for Il1b active protein
Relevance: Interleukin-1 (IL-1) designates two proteins, IL-1alpha and IL-1beta, which are the products of distinct genes, but recognize the same cell surface receptors. IL-1alpha and IL-1beta are structurally related polypeptides that show approximately 25% homology at the amino acid level. Both proteins are produced by a wide variety of cells in response to stimuli such as those produced by inflammatory agents, infections, or microbial endotoxins. The proteins are synthesized as 31 kDa precursors that are subsequently cleaved into proteins with molecular weights of approximately 17. 5 kDa. The specific protease responsible for the processing of IL-1beta, designated interleukin 1beta-converting enzyme (ICE), has been described. Mature human and mouse IL-1beta share approximately 75% amino acid sequence identity and human IL-1beta has been found to be active on murine cell lines.

Function: Potent proinflammatory cytokine. Initially discovered as the major endogenous pyrogen, induces prostaglandin synthesis, neutrophil influx and activation, T-cell activation and cytokine production, B-cell activation and antibody production, and fibroblast proliferation and collagen production.
Product Categories/Family for Il1b active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
17.4 kDa
NCBI Official Full Name
interleukin-1 beta
NCBI Official Synonym Full Names
interleukin 1 beta
NCBI Official Symbol
Il1b
NCBI Official Synonym Symbols
Il-1b; IL-1beta
NCBI Protein Information
interleukin-1 beta
UniProt Protein Name
Interleukin-1 beta
Protein Family
UniProt Gene Name
Il1b
UniProt Synonym Gene Names
IL-1 beta
UniProt Entry Name
IL1B_MOUSE

NCBI Description

The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1. The encoded protein plays a role in thymocyte proliferation and is involved in the inflammatory response. [provided by RefSeq, Aug 2015]

Uniprot Description

IL1B: Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells. Monomer. Belongs to the IL-1 family.

Protein type: Cytokine

Cellular Component: extracellular space; cell; extracellular region; intracellular; cytosol; vesicle; secretory granule

Molecular Function: protein domain specific binding; interleukin-1 receptor binding; cytokine activity; receptor binding

Biological Process: positive regulation of granulocyte macrophage colony-stimulating factor production; negative regulation of MAP kinase activity; positive regulation of JNK activity; positive regulation of nitric oxide biosynthetic process; negative regulation of glutamate secretion; activation of MAPK activity; positive regulation of apoptosis; positive regulation of interleukin-2 biosynthetic process; positive regulation of transcription, DNA-dependent; germ cell programmed cell death; negative regulation of insulin receptor signaling pathway; positive regulation of glial cell differentiation; response to lipopolysaccharide; positive regulation of NF-kappaB import into nucleus; positive regulation of lipid catabolic process; fever; positive regulation of membrane protein ectodomain proteolysis; response to carbohydrate stimulus; activation of NF-kappaB transcription factor; elevation of cytosolic calcium ion concentration; positive regulation of phagocytosis; positive regulation of T cell proliferation; positive regulation of astrocyte differentiation; neutrophil chemotaxis; positive regulation of heterotypic cell-cell adhesion; positive regulation of I-kappaB kinase/NF-kappaB cascade; positive regulation of mitosis; interleukin-1 beta production; positive regulation of interleukin-6 production; social behavior; positive regulation of angiogenesis; negative regulation of neuron differentiation; positive regulation of cell division; positive regulation of transcription from RNA polymerase II promoter; positive regulation of transcription factor activity; negative regulation of lipid metabolic process; leukocyte migration; sequestering of triacylglycerol; positive regulation of interleukin-6 biosynthetic process; positive regulation of JNK cascade; negative regulation of transcription from RNA polymerase II promoter; positive regulation of stress-activated MAPK cascade; negative regulation of neurogenesis; positive regulation of interleukin-8 production; negative regulation of cell proliferation; negative regulation of lipid catabolic process; hyaluronan biosynthetic process; protein kinase B signaling cascade; lipopolysaccharide-mediated signaling pathway; regulation of I-kappaB kinase/NF-kappaB cascade; inflammatory response; aging; cytokine and chemokine mediated signaling pathway; MAPKKK cascade; positive regulation of immature T cell proliferation in the thymus; memory; response to ATP; positive regulation of interferon-gamma production; positive regulation of chemokine biosynthetic process; positive regulation of prostaglandin secretion; positive regulation of fever; immune response; positive regulation of protein amino acid phosphorylation; regulation of insulin secretion

Research Articles on Il1b

Similar Products

Product Notes

The Il1b il1b (Catalog #AAA7115070) is an Active Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 118-269aa; Full Length of Mature Protein. The amino acid sequence is listed below: VPIRQLHYRL RDEQQKSLVL SDPYELKALH LNGQNINQQV IFSMSFVQGE PSNDKIPVAL GLKGKNLYLS CVMKDGTPTL QLESVDPKQY PKKKMEKRFV FNKIEVKSKV EFESAEFPNW YISTSQAEHK PVFLGNNSGQ DIIDFTMESV SS. It is sometimes possible for the material contained within the vial of "Interleukin-1 beta (Il1b), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.