IL-20 active protein

Recombinant Human IL-20 Protein

Cat. Num. AAA9139835

• Gene Names: IL20; IL-20; IL10D; ZCYTO10
• Purity: >95% by SDS-PAGE.
• Synonyms: IL-20; Recombinant Human IL-20 Protein; IL10D; ZCYTO10; IL-20 active protein

• Host: E Coli
• Purity/Purification: >95% by SDS-PAGE.
• Form/Format: Lyophilized from a 0.2 um filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
• Sequence: LKTLNLGSCVIATNLQEIRNGFSEIRGSVQAKDGNIDIRILRRTESLQDTKPANRCCLLRHLLRLYLDRVFKNYQTPDHYTLRKISSLANSFLTIKKDLRLCHAHMTCHCGEEAMKKYSQILSHFEKLEPQAAVVKALGELDILLQWMEETE
• Sequence Length: 176

• Species: Human
• Endotoxin: < 1 EU/ug of the protein by LAL method.
• Biological Activity: Measured in a cell proliferation assay using BaF3 mouse pro-B cells transfected with human IL-20 R alpha and human IL-20 R beta. The ED50 for this effect is 0.2-0.6 ng/mL.
• Reconstitution: Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
• Tag: No tag
• Preparation and Storage: Store the lyophilized protein at -20 degree C to -80 degree C for long term.; After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant protein Human IL-20 was determined by SDS-PAGE under reducing conditions with Coomassie Blue, showing a band at 18 kDa.)

Related Product Information for IL-20 active protein

Description: Recombinant Human IL-20 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Leu25-Glu176) of human IL-20 (Accession #Q9NYY1) fused with an initial Met at the N-terminus.

Background: This protein is a cytokine structurally related to interleukin 10 (IL10). This cytokine has been shown to transduce its signal through signal transducer and activator of transcription 3 (STAT3) in keratinocytes. A specific receptor for this cytokine is found to be expressed in skin and upregulated dramatically in psoriatic skin, suggesting a role for this protein in epidermal function and psoriasis.

Product Categories/Family for IL-20 active protein

Cytokines & Cytokine Receptors

NCBI and Uniprot Product Information

• NCBI GI #: 31083166
• NCBI GeneID: 50604
• NCBI Accession #: NP_061194.2
• NCBI GenBank Nucleotide #: NP_061194.2
• UniProt Accession #: Q9NYY1
• NCBI Official Full Name: interleukin-20
• NCBI Official Synonym Full Names: interleukin 20
• NCBI Official Symbol: IL20
• NCBI Official Synonym Symbols: IL-20; IL10D; ZCYTO10
• NCBI Protein Information: interleukin-20
• UniProt Protein Name: Interleukin-20
• UniProt Gene Name: IL20
• UniProt Synonym Gene Names: ZCYTO10; IL-20
• UniProt Entry Name: IL20_HUMAN

NCBI Description

The protein encoded by this gene is a cytokine structurally related to interleukin 10 (IL10). This cytokine has been shown to transduce its signal through signal transducer and activator of transcription 3 (STAT3) in keratinocytes. A specific receptor for this cytokine is found to be expressed in skin and upregulated dramatically in psoriatic skin, suggesting a role for this protein in epidermal function and psoriasis. [provided by RefSeq, Jul 2008]

Uniprot Description

IL20: Cytokine that may be involved in epidermal function and psoriasis. Acts through STAT3. Belongs to the IL-10 family.

Protein type: Secreted, signal peptide; Cytokine; Secreted

Chromosomal Location of Human Ortholog: 1q32

Cellular Component: extracellular space; extracellular region

Molecular Function: interleukin-20 receptor binding; interleukin-22 receptor binding; cytokine activity

Biological Process: positive regulation of osteoclast differentiation; positive regulation of epidermal cell differentiation; regulation of inflammatory response; positive regulation of JAK-STAT cascade; immune response; inflammatory response; positive regulation of keratinocyte differentiation; positive regulation of tyrosine phosphorylation of Stat3 protein