Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Granulocyte Macrophage Colony Stimulating Factor Active Protein | CSF2 active protein

Recombinant Rhesus macaque GM-CSF (rRhGM-CSF)

Gene Names
CSF2; GMCSF
Purity
>98% by SDS-PAGE and HPLC analyses.
Synonyms
Granulocyte Macrophage Colony Stimulating Factor; Recombinant Rhesus macaque GM-CSF (rRhGM-CSF); rhesus macaque GM-CSF; Rhesus macaque Granulocyte-Macrophage Colony Stimulating Factor; CSF2 active protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
>98% by SDS-PAGE and HPLC analyses.
Form/Format
Lyophilized from a 0.2mm filtered concentratedcsolution in PBS, pH 7.4.
Sequence
APARSPSPGTQPWEHVNAIQEARRLLNLSRDTAAEMNKTVEVVSEMFDLQEPSCLQ TRLELYKQGLQGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITFQSFKENLKDFLL VIPFDCWEPVQE
Sequence Length
144
Molecular Weight Information
Approximately 13.5 kDa, a single non-glycosylated polypeptide chain containing 123 amino acids.
Biological Activity
Fully biologically active when compared to standard. The ED50 as calculated by the dose-dependant stimulation of the proliferation of human TF-1 cells is less than 0.1 ng/ml, corresponding to a Specific Activity of 1.0x107 IU/mg.
Endotoxin Level
Less than 1EU/mg of rRhGM-CSF as determined by LAL method.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20 degree C. Further dilutions should be made in appropriate buffered solutions
Preparation and Storage
This lyophilized preparation is stable at 2-8 degree C, but should be kept at -20 degree C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 degree C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 degree C to -70 degree C. Avoid repeated freeze/thaw cycles.
Related Product Information for CSF2 active protein
GM-CSF was initially characterized as a growth factor that can support the in vitro colony formation of granulocyte-macrophage progenitors. It is produced by a number of different cell types (including activated T cells, B cells, macrophages, mast cells, endothelial cells and fibroblasts) in response to cytokine or immune and inflammatory stimuli. Besides granulocyte-macrophage progenitors, GMCSF is also a growth factor for erythroid, megakaryocyte and eosinophil progenitors. On mature hematopoietic cells, GM-CSF is a survival factor for and activates the effector functions of granulocytes, monocytes/macrophages and eosinophils.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
granulocyte-macrophage colony-stimulating factor
NCBI Official Synonym Full Names
colony stimulating factor 2 (granulocyte-macrophage)
NCBI Official Symbol
CSF2
NCBI Official Synonym Symbols
GMCSF
NCBI Protein Information
granulocyte-macrophage colony-stimulating factor; CSF; molgramostin; sargramostim
UniProt Protein Name
Granulocyte-macrophage colony-stimulating factor
UniProt Gene Name
CSF2
UniProt Synonym Gene Names
GMCSF; GM-CSF; CSF
UniProt Entry Name
CSF2_HUMAN

NCBI Description

The protein encoded by this gene is a cytokine that controls the production, differentiation, and function of granulocytes and macrophages. The active form of the protein is found extracellularly as a homodimer. This gene has been localized to a cluster of related genes at chromosome region 5q31, which is known to be associated with interstitial deletions in the 5q- syndrome and acute myelogenous leukemia. Other genes in the cluster include those encoding interleukins 4, 5, and 13. [provided by RefSeq, Jul 2008]

Uniprot Description

GMCSF: Cytokine that stimulates the growth and differentiation of hematopoietic precursor cells from various lineages, including granulocytes, macrophages, eosinophils and erythrocytes. Belongs to the GM-CSF family.

Protein type: Secreted; Secreted, signal peptide; Cytokine

Chromosomal Location of Human Ortholog: 5q31.1

Cellular Component: extracellular space; extracellular region

Molecular Function: protein binding; growth factor activity; granulocyte macrophage colony-stimulating factor receptor binding; cytokine activity

Biological Process: negative regulation of cytolysis; epithelial fluid transport; macrophage activation; embryonic placenta development; positive regulation of tyrosine phosphorylation of Stat5 protein; positive regulation of interleukin-23 production; positive regulation of cell proliferation; immune response; myeloid dendritic cell differentiation; positive regulation of DNA replication

Research Articles on CSF2

Similar Products

Product Notes

The CSF2 csf2 (Catalog #AAA546132) is an Active Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: APARSPSPGT QPWEHVNAIQ EARRLLNLSR DTAAEMNKTV EVVSEMFDLQ EPSCLQ TRLELYKQGL QGSLTKLKGP LTMMASHYKQ HCPPTPETSC ATQIITFQSF KENLKDFLL VIPFDCWEPV QE. It is sometimes possible for the material contained within the vial of "Granulocyte Macrophage Colony Stimulating Factor, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.