Granulocyte-Macrophage Colony-Stimulating Factor (Csf2) Active Protein | Csf2 active protein
Recombinant Mouse Granulocyte-Macrophage Colony-Stimulating Factor (Csf2)
Gene Names
Csf2; CSF; Csfgm; GMCSF; Gm-CSf; MGI-IGM
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Granulocyte-Macrophage Colony-Stimulating Factor (Csf2); Recombinant Mouse Granulocyte-Macrophage Colony-Stimulating Factor (Csf2); Granulocyte-macrophage colony-stimulating factor; Csf2; GM-CSF; Colony-stimulating factor; Csfgm; Csf2 active protein
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized from a 0.2 mum Filtered 20 mM PB, 150 mM NaCl, pH 7.4
Sequence Positions
18-141aa; Full Length of Mature Protein
Sequence
APTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPGQK
Sequence Length
141
Species
Mouse
Tag
Tag-Free
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined in a cell proliferation assay using PDC-P1 cells is less than 100 pg/ml.
Subcellular Location
Secreted
Protein Families
GM-CSF Family
Classification
Cytokine
Subdivision
Colony Stimulating Factor
Preparation and Storage
Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for Csf2 active protein
Relevance: Granulocyte-Macrophage Colony Stimulating Factor (GM-CSF) was initially characterized as a growth factorthat can support the in vitro colony formation of granulocyte-macrophage progenitors. It is produced by anumber of different cell types (including activated T cells, B cells, macrophages, mast cells, endothelial cellsand fibroblasts) in response to cytokine of immune and inflammatory stimuli. Besides granulocyte-macrophageprogenitors, GM-CSF is also a growth factor for erythroid, megakaryocyte and eosinophil progenitors. Onmature hematopoietic, monocytes/ macrophages and eosinophils. GM-CSF has a functional role on nonhematopoitic cells. It can induce human endothelial cells to migrate and proliferate. Additionally, GM-CSF canalso stimulate the proliferation of a number of tumor cell lines, including osteogenic sarcoma, carcinoma andadenocarcinoma cell lines.
Function: Cytokine that stimulates the growth and differentiation of hematopoietic precursor cells from various lineages, including granulocytes, macrophages, eosinophils and erythrocytes.
Function: Cytokine that stimulates the growth and differentiation of hematopoietic precursor cells from various lineages, including granulocytes, macrophages, eosinophils and erythrocytes.
Product Categories/Family for Csf2 active protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
14.2 kDa
NCBI Official Full Name
granulocyte-macrophage colony-stimulating factor
NCBI Official Synonym Full Names
colony stimulating factor 2 (granulocyte-macrophage)
NCBI Official Symbol
Csf2
NCBI Official Synonym Symbols
CSF; Csfgm; GMCSF; Gm-CSf; MGI-IGM
NCBI Protein Information
granulocyte-macrophage colony-stimulating factor
UniProt Protein Name
Granulocyte-macrophage colony-stimulating factor
Protein Family
UniProt Gene Name
Csf2
UniProt Synonym Gene Names
Csfgm; GM-CSF; CSF
UniProt Entry Name
CSF2_MOUSE
Uniprot Description
GMCSF: Cytokine that stimulates the growth and differentiation of hematopoietic precursor cells from various lineages, including granulocytes, macrophages, eosinophils and erythrocytes. Belongs to the GM-CSF family.
Protein type: Secreted; Cytokine; Secreted, signal peptide
Cellular Component: extracellular space; extracellular region
Molecular Function: growth factor activity; granulocyte macrophage colony-stimulating factor receptor binding; cytokine activity
Biological Process: negative regulation of cytolysis; epithelial fluid transport; embryonic placenta development; macrophage activation; positive regulation of tyrosine phosphorylation of Stat5 protein; regulation of gene expression; positive regulation of interleukin-23 production; positive regulation of cell proliferation; myeloid dendritic cell differentiation; immune response; positive regulation of DNA replication; regulation of cell proliferation
Research Articles on Csf2
Similar Products
Product Notes
The Csf2 csf2 (Catalog #AAA7114963) is an Active Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 18-141aa; Full Length of Mature Protein. The amino acid sequence is listed below: APTRSPITVT RPWKHVEAIK EALNLLDDMP VTLNEEVEVV SNEFSFKKLT CVQTRLKIFE QGLRGNFTKL KGALNMTASY YQTYCPPTPE TDCETQVTTY ADFIDSLKTF LTDIPFECKK PGQK. It is sometimes possible for the material contained within the vial of "Granulocyte-Macrophage Colony-Stimulating Factor (Csf2), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
