Fractalkine Active Protein | CX3CL1 active protein
Recombinant Human Fractalkine (CX3CL1)
Gene Names
CX3CL1; NTN; NTT; CXC3; CXC3C; SCYD1; ABCD-3; C3Xkine; fractalkine; neurotactin
Purity
Greater than 97.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Synonyms
Fractalkine; Recombinant Human Fractalkine (CX3CL1); Fractalkine Human; Fractalkine Human Recombinant (CX3CL1); CX3CL1; Neurotactin; CX3C membrane-anchored chemokine; Small inducible cytokine D1; NTN; NTT; CXC3; CXC3C; SCYD1; ABCD-3; C3Xkine; CX3CL1 active protein
Host
E Coli
Purity/Purification
Greater than 97.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Form/Format
The CX3CL1 was lyophilized from a 0.2um filtered concentrated (1.0 mg/ml) solution in 20mM Phosphate buffer, pH 7.4, 50mM NaCl.
Sterile Filtered White lyophilized (freeze-dried) powder.
Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence
QHHGVTKCNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQHRLFCADPKEQW VKDAMQHLDRQAAALTRNG
Sequence Length
397
Solubility
It is recommended to reconstitute the lyophilized CX3CL1 in sterile 18M Omega -cm H2O not less than 100 ug/ml, which can then be further diluted to other aqueous solutions.
Biological Activity
The Biological activity is calculated by its ability to chemoattract human T-Lymphocytes using a concentration range of 5.0-10.0 ng/ml corresponding to a Specific Activity of 100,000-200,000IU/mg.
Preparation and Storage
Lyophilized CX3CL1 although stable at room temperature for 3 weeks, should be stored desiccated below -18 degree C. Upon reconstitution CX3CL1 should be stored at 4 degree C between 2-7 days and for future use below -18 degree C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
Related Product Information for CX3CL1 active protein
Description: Fractalkine Human Recombinant- produced in E Coli is a single,non-glycosylated, polypeptide chain containing 76 amino acids and having a molecular mass of 8638 Dalton. The Fractalkine is purified by proprietary chromatographic techniques.
Introduction: Fractalkine soluble form is chemotactic for t-cells and monocytes, but not for neutrophils. Fractalkine membrane-bound form promotes adhesion of those leukocytes to endothelial cells. Fractalkine regulates leukocyte adhesion and migration processes at the endothelium and binds to CX3CR1. Natural Human Fractalkine is produced as a long protein (373-amino acid) with an extended mucin-like stalk and a chemokine domain on top. The mucin-like stalk permits it to bind to the cell surface. Fractalkine gene is located on human chromosome 16 along with some CC chemokines known as CCL17 and CCL22.
Introduction: Fractalkine soluble form is chemotactic for t-cells and monocytes, but not for neutrophils. Fractalkine membrane-bound form promotes adhesion of those leukocytes to endothelial cells. Fractalkine regulates leukocyte adhesion and migration processes at the endothelium and binds to CX3CR1. Natural Human Fractalkine is produced as a long protein (373-amino acid) with an extended mucin-like stalk and a chemokine domain on top. The mucin-like stalk permits it to bind to the cell surface. Fractalkine gene is located on human chromosome 16 along with some CC chemokines known as CCL17 and CCL22.
Product Categories/Family for CX3CL1 active protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
42,203 Da
NCBI Official Full Name
fractalkine isoform 1
NCBI Official Synonym Full Names
chemokine (C-X3-C motif) ligand 1
NCBI Official Symbol
CX3CL1
NCBI Official Synonym Symbols
NTN; NTT; CXC3; CXC3C; SCYD1; ABCD-3; C3Xkine; fractalkine; neurotactin
NCBI Protein Information
fractalkine; C-X3-C motif chemokine 1; CX3C membrane-anchored chemokine; small inducible cytokine subfamily D (Cys-X3-Cys), member 1 (fractalkine, neurotactin); small inducible cytokine subfamily D (Cys-X3-Cys), member-1; small-inducible cytokine D1
UniProt Protein Name
Fractalkine
Protein Family
UniProt Gene Name
CX3CL1
UniProt Synonym Gene Names
FKN; NTT; SCYD1
UniProt Entry Name
X3CL1_HUMAN
Uniprot Description
CX3CL1: The soluble form is chemotactic for T-cells and monocytes, but not for neutrophils. The membrane-bound form promotes adhesion of those leukocytes to endothelial cells. May play a role in regulating leukocyte adhesion and migration processes at the endothelium. Binds to CX3CR1. Belongs to the intercrine delta family.
Protein type: Motility/polarity/chemotaxis; Membrane protein, integral
Chromosomal Location of Human Ortholog: 16q13
Cellular Component: extracellular space; cell surface; integral to membrane; extracellular region; plasma membrane
Molecular Function: protein binding; chemokine activity; receptor binding
Biological Process: neutrophil chemotaxis; positive regulation of transforming growth factor-beta1 production; leukocyte chemotaxis; cytokine and chemokine mediated signaling pathway; defense response; chemotaxis; angiogenesis involved in wound healing; leukocyte adhesive activation; macrophage chemotaxis; positive regulation of angiogenesis; positive regulation of calcium-independent cell-cell adhesion; immune response; cell adhesion; lymphocyte chemotaxis; positive regulation of inflammatory response
Research Articles on CX3CL1
Similar Products
Product Notes
The CX3CL1 cx3cl1 (Catalog #AAA143175) is an Active Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: QHHGVTKCNI TCSKMTSKIP VALLIHYQQN QASCGKRAII LETRQHRLFC ADPKEQW VKDAMQHLDR QAAALTRNG. It is sometimes possible for the material contained within the vial of "Fractalkine, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
