C-X-C Motif Chemokine 2 (CXCL2) Active Protein | CXCL2 active protein

Recombinant Human C-X-C Motif Chemokine 2 (CXCL2), Partial

Cat. Num. AAA7114951

• Gene Names: CXCL2; GRO2; GROb; MIP2; MIP2A; SCYB2; MGSA-b; MIP-2a; CINC-2a
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: C-X-C Motif Chemokine 2 (CXCL2); Recombinant Human C-X-C Motif Chemokine 2 (CXCL2); Partial; C-X-C Motif Chemokine 2; Growth-Regulated Protein Beta; Gro-Beta; Macrophage Inflammatory Protein 2-Alpha; MIP2-Alpha; CXCL2; GRO2; GROB; MIP2A; SCYB2; CXCL2 active protein

• Host: E Coli
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized from a 0.2 mum Filtered 20 mM Tris-HCl, 400 mM NaCl, pH 8.5
• Sequence Positions: 39-107aa; Partial
• Sequence: TELRCQCLQTLQGIHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN
• Sequence Length: 73

• Species: Human
• Tag: Tag-Free
• Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
• Biological Activity: The ED50 as determined by its ability to activate chimeric receptor and induce reporter gene expression in HEK293 cell line used Splite TEV activity detection platform is less than 10 ng/mL.
• Subcellular Location: Secreted
• Protein Families: Intercrine alpha (chemokine CxC) Family
• Classification: Cytokine
• Subdivision: Chemokine
• Pathway: Chemokine Signaling Pathway
• Preparation and Storage: Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Related Product Information for CXCL2 active protein

Relevance: Chemokine Ligand 2 (CXCL2) is a small secreted cytokine which belongs to the CXC chemokine family. It is secreted by monocytes and macrophages and chemotactic for polymorphonuclear leukocytes and hematopoietic stem cells. CXCL2 mobilizes cells by interacting with a cell surface chemokine receptor called CXCR2. It has been known to regulate immune functions mainly by chemo-attracting neutrophils. It is produced by activated monocytes and neutrophils and expressed at sites of inflammation. It is a hematoregulatory chemokine, which suppresses hematopoietic progenitor cell proliferation. It can be induced by receptor activator of NF-kappaB ligand, the osteoclast (OC) differentiation factor, through JNK and NF-kappaB signaling pathways in OC precursor cells. CXCL2 in turn enhanced the proliferation of OC precursor cells of bone marrow-derived macrophages (BMMs) through the activation of ERK. Knockdown of CXCL2 inhibited both the proliferation of and the ERK activation in BMMs. During osteoclastogenesis CXCL2 stimulated the adhesion and the migration of BMMs. CXCL2 is a novel therapeutic target for inflammatory bone destructive diseases.

Function: Produced by activated monocytes and neutrophils and expressed at sites of inflammation. Hematoregulatory chemokine, which, in vitro, suppresses hematopoietic progenitor cell proliferation. GRO-beta(5-73) shows a highly enhanced hematopoietic activity.

Product Categories/Family for CXCL2 active protein

Immunology

NCBI and Uniprot Product Information

• NCBI GI #: 2905630
• NCBI GeneID: 2920
• UniProt Accession #: P19875
• Molecular Weight: 7.67 kDa
• NCBI Official Full Name: macrophage inflammatory protein 2 alpha, partial
• NCBI Official Synonym Full Names: C-X-C motif chemokine ligand 2
• NCBI Official Symbol: CXCL2
• NCBI Official Synonym Symbols: GRO2; GROb; MIP2; MIP2A; SCYB2; MGSA-b; MIP-2a; CINC-2a
• NCBI Protein Information: C-X-C motif chemokine 2
• UniProt Protein Name: C-X-C motif chemokine 2
• Protein Family: C-X-C motif chemokine
• UniProt Gene Name: CXCL2
• UniProt Synonym Gene Names: GRO2; GROB; MIP2A; SCYB2; Gro-beta; MIP2-alpha; HSF
• UniProt Entry Name: CXCL2_HUMAN

NCBI Description

This antimicrobial gene is part of a chemokine superfamily that encodes secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the arrangement of the N-terminal cysteine residues of the mature peptide. This chemokine, a member of the CXC subfamily, is expressed at sites of inflammation and may suppress hematopoietic progenitor cell proliferation. [provided by RefSeq, Sep 2014]

Uniprot Description

CXCL2: Produced by activated monocytes and neutrophils and expressed at sites of inflammation. Hematoregulatory chemokine, which, in vitro, suppresses hematopoietic progenitor cell proliferation. GRO-beta(5-73) shows a highly enhanced hematopoietic activity. Belongs to the intercrine alpha (chemokine CxC) family.

Protein type: Secreted, signal peptide; Motility/polarity/chemotaxis; Secreted

Chromosomal Location of Human Ortholog: 4q21

Cellular Component: extracellular space; extracellular region

Molecular Function: protein binding; chemokine activity; CXCR chemokine receptor binding

Biological Process: G-protein coupled receptor protein signaling pathway; response to molecule of bacterial origin; response to lipopolysaccharide; immune response; positive regulation of leukocyte chemotaxis; chemotaxis; inflammatory response; regulation of cell proliferation