C-C Motif Chemokine 3 (CCL3) Active Protein | CCL3 active protein

Recombinant Human C-C Motif Chemokine 3 (CCL3)

Cat. Num. AAA7114950

• Gene Names: CCL3; MIP1A; SCYA3; G0S19-1; LD78ALPHA; MIP-1-alpha
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: C-C Motif Chemokine 3 (CCL3); Recombinant Human C-C Motif Chemokine 3 (CCL3); C-C Motif Chemokine 3; G0/G1 Switch Regulatory Protein 19-1; Macrophage Inflammatory Protein 1-Alpha; MIP-1-Alpha; PAT 464.1; SIS-Beta; Small-Inducible Cytokine A3; Tonsillar Lymphocyte LD78 Alpha Protein; CCL3; G0S19-1; MIP1A; SCYA3; CCL3 active protein

• Host: E Coli
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized from a 0.2 mum Filtered 20 mM PB, 150 mM NaCl, pH 7.4
• Sequence Positions: 24-92aa; Full Length of Mature Protein
• Sequence: SLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA
• Sequence Length: 70

• Species: Human
• Tag: Tag-Free
• Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
• Biological Activity: The ED50 as determined by the ability of Recombinant CCL3 to chemoattract human CCR5 transfected BaF3 mouse proB cells is typically 3-10 ng/mL.
• Subcellular Location: Secreted
• Protein Families: Intercrine beta (chemokine CC) Family
• Classification: Cytokine
• Subdivision: Chemokine
• Pathway: Chemokine Signaling Pathway
• Preparation and Storage: Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Related Product Information for CCL3 active protein

Relevance: Human Chemokine (C-C Motif) Ligand 3 (CCL3) is a small cytokine belonging to the CC chemokine family. CCL3 is primarily expressed in T cells, B cells, and monocytes after antigen or mitogen stimulation. CCL3 exhibits chemoattractive and adhesive effects on lymphocytes. CCL3 exerts multiple effects on hematopoietic precursor cells and inhibits the proliferation of hematopoietic stem cells in vitro as well as in vivo. CCR1 and CCR5 have been identified as functional receptors for CCL3.

Function: Monokine with inflammatory and chemokinetic properties. Binds to CCR1, CCR4 and CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant MIP-1-alpha induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV).

Product Categories/Family for CCL3 active protein

Immunology

NCBI and Uniprot Product Information

• NCBI GI #: 2905628
• NCBI GeneID: 6348
• UniProt Accession #: P10147
• Molecular Weight: 7.5 kDa
• NCBI Official Full Name: macrophage inflammatory protein 1 alpha, partial
• NCBI Official Synonym Full Names: C-C motif chemokine ligand 3
• NCBI Official Symbol: CCL3
• NCBI Official Synonym Symbols: MIP1A; SCYA3; G0S19-1; LD78ALPHA; MIP-1-alpha
• NCBI Protein Information: C-C motif chemokine 3
• UniProt Protein Name: C-C motif chemokine 3
• Protein Family: C-C motif chemokine
• UniProt Gene Name: CCL3
• UniProt Synonym Gene Names: G0S19-1; MIP1A; SCYA3; MIP-1-alpha
• UniProt Entry Name: CCL3_HUMAN

NCBI Description

This locus represents a small inducible cytokine. The encoded protein, also known as macrophage inflammatory protein 1 alpha, plays a role in inflammatory responses through binding to the receptors CCR1, CCR4 and CCR5. Polymorphisms at this locus may be associated with both resistance and susceptibility to infection by human immunodeficiency virus type 1.[provided by RefSeq, Sep 2010]

Uniprot Description

CCL3: Monokine with inflammatory and chemokinetic properties. Binds to CCR1, CCR4 and CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant MIP-1-alpha induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). Belongs to the intercrine beta (chemokine CC) family.

Protein type: Secreted; Motility/polarity/chemotaxis; Chemokine; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 17q12

Cellular Component: extracellular space; cytoplasm; extracellular region; intracellular; cytosol

Molecular Function: identical protein binding; CCR1 chemokine receptor binding; protein binding; chemokine activity; calcium-dependent protein kinase C activity; kinase activity; CCR5 chemokine receptor binding; protein kinase activity; chemoattractant activity; phospholipase activator activity

Biological Process: positive regulation of catalytic activity; negative regulation of osteoclast differentiation; exocytosis; behavior; response to toxin; positive regulation of calcium-mediated signaling; positive regulation of interleukin-1 beta secretion; chemotaxis; protein amino acid phosphorylation; regulation of cell shape; monocyte chemotaxis; negative regulation of bone mineralization; cell-cell signaling; positive chemotaxis; positive regulation of neuron apoptosis; calcium ion transport; protein kinase B signaling cascade; lipopolysaccharide-mediated signaling pathway; inflammatory response; lymphocyte chemotaxis; neutrophil chemotaxis; calcium-mediated signaling; MAPKKK cascade; cytoskeleton organization and biogenesis; release of sequestered calcium ion by sarcoplasmic reticulum into cytosol; positive regulation of tumor necrosis factor production; macrophage chemotaxis; cellular calcium ion homeostasis; osteoblast differentiation; positive regulation of protein kinase B signaling cascade; cell activation; eosinophil chemotaxis; eosinophil degranulation; regulation of sensory perception of pain; positive regulation of calcium ion transport; astrocyte cell migration; positive regulation of inflammatory response; positive regulation of cell migration

Disease: Human Immunodeficiency Virus Type 1, Susceptibility To