BAFF active protein

Recombinant Human BAFF (BLyS) Receptor

Cat. Num. AAA142305

• Gene Names: TNFRSF13C; BAFFR; CD268; CVID4; BAFF-R; BROMIX; prolixin
• Purity: Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
• Synonyms: BAFF; Recombinant Human BAFF (BLyS) Receptor; BAFF R Human; B-cell Activating Factor Receptor Human Recombinant; TNFRSF13C; CD268; BAFF-R; MGC138235; B cell-activating factor receptor; BAFF R; BAFF active protein

• Host: E Coli
• Purity/Purification: Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
• Form/Format: Lyophilized from a 0.2um filtered concentrated (1.0mg/ml) solution in 20mM PB, pH 8.0, 500mM NaCl.; Sterile Filtered White lyophilized (freeze-dried) powder.
• Sequence: MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAALPLPG
• Sequence Length: 184

• Solubility: It is recommended to reconstitute the lyophilized B Lymphocyte Stimulator Receptor Recombinant in sterile 18M Omega -cm H2O not less than 100 ug/ml, which can then be further diluted to other aqueous solutions.
• Biological Activity: Determined by its ability to block BAFF induced mouse splenocyte survival. The expected ED50 for this effect is 1.0-5.0 ug/ml in the presence of 1.0 ug/ml of human soluble BAFF.
• Preparation and Storage: Lyophilized BAFF-R although stable at room temperature for 3 weeks, should be stored desiccated below -18 degree C. Upon reconstitution B Lymphocyte Stimulator Receptor should be stored at 4 degree C between 2-7 days and for future use below -18 degree C.Please prevent freeze-thaw cycles.

Related Product Information for BAFF active protein

Description: B Lymphocyte Stimulator Receptor Human Recombinant extracellular produced in E Coli is a single, non-glycosylated polypeptide chain containing 76 amino acids and having a molecular mass of 7.7 kDa.The BAFF-R is purified by proprietary chromatographic techniques.

Introduction: B cell-activating factor (BAFF) enhances B-cell survival in vitro and is a regulator of the peripheral B-cell population. Overexpression of Baff in mice results in mature B-cell hyperplasia and symptoms of systemic lupus erythematosus (SLE). Also, some SLE patients have increased levels of BAFF in serum. Therefore, it has been proposed that abnormally high levels of BAFF may contribute to the pathogenesis of autoimmune diseases by enhancing the survival of autoreactive B cells. The protein encoded by this gene is a receptor for BAFF and is a type III transmembrane protein containing a single extracellular cysteine-rich domain. It is thought that this receptor is the principal receptor required for BAFF-mediated mature B-cell survival.

Product Categories/Family for BAFF active protein

Cytokines and Growth Factors; Cytokines; B-Cell Activating Factor

NCBI and Uniprot Product Information

• NCBI GI #: 16445027
• NCBI GeneID: 115650
• NCBI Accession #: NP_443177.1
• NCBI GenBank Nucleotide #: NM_052945.3
• UniProt Accession #: Q96RJ3
• Molecular Weight: 18,935 Da
• NCBI Official Full Name: tumor necrosis factor receptor superfamily member 13C
• NCBI Official Synonym Full Names: tumor necrosis factor receptor superfamily, member 13C
• NCBI Official Symbol: TNFRSF13C
• NCBI Official Synonym Symbols: BAFFR; CD268; CVID4; BAFF-R; BROMIX; prolixin
• NCBI Protein Information: tumor necrosis factor receptor superfamily member 13C; B cell-activating factor receptor; B-cell-activating factor receptor; BAFF receptor; BLyS receptor 3
• UniProt Protein Name: Tumor necrosis factor receptor superfamily member 13C
• UniProt Gene Name: TNFRSF13C
• UniProt Synonym Gene Names: BAFFR; BR3; BAFF-R
• UniProt Entry Name: TR13C_HUMAN

NCBI Description

B cell-activating factor (BAFF) enhances B-cell survival in vitro and is a regulator of the peripheral B-cell population. Overexpression of Baff in mice results in mature B-cell hyperplasia and symptoms of systemic lupus erythematosus (SLE). Also, some SLE patients have increased levels of BAFF in serum. Therefore, it has been proposed that abnormally high levels of BAFF may contribute to the pathogenesis of autoimmune diseases by enhancing the survival of autoreactive B cells. The protein encoded by this gene is a receptor for BAFF and is a type III transmembrane protein containing a single extracellular cysteine-rich domain. It is thought that this receptor is the principal receptor required for BAFF-mediated mature B-cell survival. [provided by RefSeq, Jul 2008]

Uniprot Description

BAFF-R: B-cell receptor specific for TNFSF13B/TALL1/BAFF/BLyS. Promotes the survival of mature B-cells and the B-cell response. Defects in TNFRSF13C are the cause of immunodeficiency common variable type 4 (CVID4); also called antibody deficiency due to BAFFR defect. CVID4 is a primary immunodeficiency characterized by antibody deficiency, hypogammaglobulinemia, recurrent bacterial infections and an inability to mount an antibody response to antigen. The defect results from a failure of B-cell differentiation and impaired secretion of immunoglobulins; the numbers of circulating B-cells is usually in the normal range, but can be low. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Receptor, misc.; Cell cycle regulation; Cell surface

Chromosomal Location of Human Ortholog: 22q13.1-q13.31

Cellular Component: integral to membrane; external side of plasma membrane

Biological Process: B cell costimulation; B cell homeostasis; T cell costimulation; positive regulation of B cell proliferation; positive regulation of germinal center formation; positive regulation of T cell proliferation; positive regulation of interferon-gamma biosynthetic process

Disease: Immunodeficiency, Common Variable, 2; Immunodeficiency, Common Variable, 4