Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Arginase-1 (ARG1) Active Protein | ARG1 active protein

Recombinant Human Arginase-1 (ARG1)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Arginase-1 (ARG1); Recombinant Human Arginase-1 (ARG1); Arginase-1; Liver-type arginase; Type I arginase; ARG1; ARG1 active protein
Ordering
For Research Use Only!
Host
E Coli
Specificity
Within the immune system initially reported to be selectively expressed in granulocytes (polymorphonuclear leukocytes [PMNs]) (PubMed:15546957). Also detected in macrophages mycobacterial granulomas (PubMed:23749634). Expressed in group2 innate lymphoid cells (ILC2s) during lung disease (PubMed:27043409).
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
0.2 mum Filtered 20 mM Tris-HCl, 150 mM NaCl, 20% Glycerol, 1 mM DTT, pH 7.4
Sequence Positions
1-322aa; Full Length
Sequence
MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNPPK
Sequence Length
322
Species
Human
Tag
C-terminal 6xHis-tagged
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
Specific activity as determined by the production of urea during the hydrolysis of arginine is greater than 30000 pmol/min/ug.
Subcellular Location
Cytoplasm, Cytoplasmic Granule
Protein Families
Arginase Family
Classification
Other Recombinant Protein
Preparation and Storage
Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for ARG1 active protein
Relevance: ARG1 is a member of the ureohydrolase family of enzymes. ARG1 can catalyze the hydrolysis of arginine to ornithine and urea. In the urea cycle, ARG1 catalyzes the fifth and final step, a series of biochemical reactions in mammals during which the body disposes of harmful ammonia. ARG1 is a cytosolic enzyme and expressed widely in the liver as part of the urea cycle. Inherited deficiency of this ARG1 causes argininemia, which is an autosomal recessive disorder characterized by hyperammonemia.

Function: Key element of the urea cycle converting L-arginine to urea and L-ornithine, which is further metabolized into metabolites proline and polyamides that drive collagen synthesis and bioenergetic pathways critical for cell proliferation, respectively; the urea cycle takes place primarily in the liver and, to a lesser extent, in the kidneys.
Product Categories/Family for ARG1 active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
383
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35.8 kDa
NCBI Official Full Name
arginase-1 isoform 2
NCBI Official Synonym Full Names
arginase 1
NCBI Official Symbol
ARG1
NCBI Protein Information
arginase-1
UniProt Protein Name
Arginase-1
Protein Family
UniProt Gene Name
ARG1
UniProt Entry Name
ARGI1_HUMAN

NCBI Description

Arginase catalyzes the hydrolysis of arginine to ornithine and urea. At least two isoforms of mammalian arginase exist (types I and II) which differ in their tissue distribution, subcellular localization, immunologic crossreactivity and physiologic function. The type I isoform encoded by this gene, is a cytosolic enzyme and expressed predominantly in the liver as a component of the urea cycle. Inherited deficiency of this enzyme results in argininemia, an autosomal recessive disorder characterized by hyperammonemia. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2011]

Uniprot Description

ARG1: Homotrimer. By arginine or homoarginine. Belongs to the arginase family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Amino Acid Metabolism - arginine and proline; Hydrolase; EC 3.5.3.1

Chromosomal Location of Human Ortholog: 6q23

Cellular Component: extracellular space; neuron projection; cell soma; cytoplasm; cytosol; nucleus

Molecular Function: manganese ion binding; arginase activity

Biological Process: response to drug; mammary gland involution; maternal process involved in pregnancy; response to herbicide; liver development; response to amino acid stimulus; response to vitamin A; response to manganese ion; response to selenium ion; response to vitamin E; response to cadmium ion; response to zinc ion; response to methylmercury; arginine catabolic process; positive regulation of endothelial cell proliferation; response to axon injury; collagen biosynthetic process; response to amine stimulus; urea cycle; lung development

Disease: Argininemia

Research Articles on ARG1

Similar Products

Product Notes

The ARG1 arg1 (Catalog #AAA7115153) is an Active Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-322aa; Full Length. The amino acid sequence is listed below: MSAKSRTIGI IGAPFSKGQP RGGVEEGPTV LRKAGLLEKL KEQECDVKDY GDLPFADIPN DSPFQIVKNP RSVGKASEQL AGKVAEVKKN GRISLVLGGD HSLAIGSISG HARVHPDLGV IWVDAHTDIN TPLTTTSGNL HGQPVSFLLK ELKGKIPDVP GFSWVTPCIS AKDIVYIGLR DVDPGEHYIL KTLGIKYFSM TEVDRLGIGK VMEETLSYLL GRKKRPIHLS FDVDGLDPSF TPATGTPVVG GLTYREGLYI TEEIYKTGLL SGLDIMEVNP SLGKTPEEVT RTVNTAVAIT LACFGLAREG NHKPIDYLNP PK. It is sometimes possible for the material contained within the vial of "Arginase-1 (ARG1), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.