Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Dynein light chain 1, cytoplasmic protein Recombinant Protein | DYNLL1 recombinant protein

Recombinant human Dynein light chain 1, cytoplasmic protein

Gene Names
DYNLL1; LC8; PIN; DLC1; DLC8; LC8a; DNCL1; hdlc1; DNCLC1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Dynein light chain 1; cytoplasmic protein; Recombinant human Dynein light chain 1; DYNLL1 recombinant protein
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence
MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG
Preparation and Storage
Store at -20 degree C. For extended storage, conserve at -20 or -80 degree C.

SDS-PAGE

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36 KD
NCBI Official Full Name
Homo sapiens dynein, light chain, LC8-type 1 (DYNLL1), transcript variant 3, mRNA
NCBI Official Synonym Full Names
dynein, light chain, LC8-type 1
NCBI Official Symbol
DYNLL1
NCBI Official Synonym Symbols
LC8; PIN; DLC1; DLC8; LC8a; DNCL1; hdlc1; DNCLC1
NCBI Protein Information
dynein light chain 1, cytoplasmic; 8 kDa dynein light chain; cytoplasmic dynein light polypeptide; dynein, cytoplasmic, light polypeptide 1; protein inhibitor of neuronal nitric oxide synthase
UniProt Protein Name
Dynein light chain 1, cytoplasmic
UniProt Gene Name
DYNLL1
UniProt Synonym Gene Names
DLC1; DNCL1; DNCLC1; HDLC1; DLC8; PIN
UniProt Entry Name
DYL1_HUMAN

NCBI Description

Cytoplasmic dyneins are large enzyme complexes with a molecular mass of about 1,200 kD. They contain two force-producing heads formed primarily from dynein heavy chains, and stalks linking the heads to a basal domain, which contains a varying number of accessory intermediate chains. The complex is involved in intracellular transport and motility. The protein described in this record is a light chain and exists as part of this complex but also physically interacts with and inhibits the activity of neuronal nitric oxide synthase. Binding of this protein destabilizes the neuronal nitric oxide synthase dimer, a conformation necessary for activity, and it may regulate numerous biologic processes through its effects on nitric oxide synthase activity. Alternate transcriptional splice variants have been characterized. [provided by RefSeq, Jul 2008]

Uniprot Description

Function: Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. May play a role in changing or maintaining the spatial distribution of cytoskeletal structures. Ref.3 Ref.5 Ref.7 Ref.9Binds and inhibits the catalytic activity of neuronal nitric oxide synthase. Ref.3 Ref.5 Ref.7 Ref.9Promotes transactivation functions of ESR1 and plays a role in the nuclear localization of ESR1. Ref.3 Ref.5 Ref.7 Ref.9Regulates apoptotic activities of BCL2L11 by sequestering it to microtubules. Upon apoptotic stimuli the BCL2L11-DYNLL1 complex dissociates from cytoplasmic dynein and translocates to mitochondria and sequesters BCL2 thus neutralizing its antiapoptotic activity. Ref.3 Ref.5 Ref.7 Ref.9

Subunit structure: Homodimer. Monomer; the monomeric form is incapable of binding to target proteins. The cytoplasmic dynein 1 complex consists of two catalytic heavy chains (HCs) and a number of non-catalytic subunits presented by intermediate chains (ICs), light intermediate chains (LICs) and light chains (LCs); the composition seems to vary in respect to the IC, LIC and LC composition. The heavy chain homodimer serves as a scaffold for the probable homodimeric assembly of the respective non-catalytic subunits. The ICs and LICs bind directly to the HC dimer and the LCs assemble on the IC dimer. Interacts with rabies P protein

By similarity. Interacts with TXNDC17. Interacts with WWC1 and ESR1. The WWC1-DYNLL1 interaction is mandatory for the recruitment and transactivation functions of ESR1 or DYNLL1 to the target chromatin. Interacts with BCL2L11 isoform 1 and isoform 2. Interacts with BCL2; the interaction is greatly enhanced in the nucleus and in mitochondria upon induction of apoptosis. Interacts with PAK1; the interaction requires dimeric DYNLL1. Interacts with human spumaretrovirus Gag protein; this interaction is critical for intracellular microtubule-dependent viral genome transport toward the centrosome. Interacts with MYZAP. Part of an astrin (SPAG5)-kinastrin (SKAP) complex containing SKAP, SPAG5, PLK1, DYNLL1 and SGOL2. Ref.3 Ref.4 Ref.5 Ref.6 Ref.7 Ref.9 Ref.10 Ref.11 Ref.14

Subcellular location: Cytoplasm › cytoskeleton. Nucleus. Mitochondrion. Note: Upon induction of apoptosis translocates together with BCL2L11 to mitochondria. Ref.1 Ref.7

Tissue specificity: Ubiquitous. Ref.1

Induction: Up-regulated by PAK1 and estrogen. Ref.3 Ref.5 Ref.7

Post-translational modification: Phosphorylation at Ser-88 appears to control the dimer-monomer transition. According to Ref.5, it is phosphorylated at Ser-88 by PAK1, however, according to Ref.11, the DYNLL1 dimer is not accessible for PAK1 and the phosphorylation could not be demonstrated in vitro. Ref.5 Ref.12

Sequence similarities: Belongs to the dynein light chain family.

Research Articles on DYNLL1

Similar Products

Product Notes

The DYNLL1 dynll1 (Catalog #AAA717236) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: MCDRKAVIKN ADMSEEMQQD SVECATQALE KYNIEKDIAA HIKKEFDKKY NPTWHCIVGR NFGSYVTHET KHFIYFYLGQ VAILLFKSG. It is sometimes possible for the material contained within the vial of "Dynein light chain 1, cytoplasmic protein, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual