Dystonin (Dst) Recombinant Protein | Dst recombinant protein
Recombinant Mouse Dystonin (Dst) , partial
Gene Names
Dst; ah; dt; Bpag; BP230; Bpag1; Macf2; nmf203; nmf339; BPAG1-n; AW554249; athetoid; mKIAA0728; 2310001O04Rik; A830042E19Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Dystonin (Dst); Recombinant Mouse Dystonin (Dst); partial; Dst recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
35-352, Partial, provide the Actin-binding domain.
Sequence
KVQKKTFTKWINQHLMKVRKHVNDLYEDLRDGHNLISLLEVLSGDTLPREKGRMRFHRLQNVQIALDYLKRRQVKLVNIRNDDITDGNPKLTLGLIWTIILHFQISDIHVTGESEDMSAKERLLLWTQQATEGYAGVRCENFTTCWRDGKLFNAIIHKYRPDLIDMNTVAVQSNLANLEHAFYVAEKIGVIRLLDPEDVDVSSPDEKSVITYVSSLYD
Sequence Length
352
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Dst recombinant protein
This gene encodes a member of the plakin protein family of adhesion junction plaque proteins. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene, but the full-length nature of some variants has not been defined. It has been known that some isoforms are expressed in neural and muscle tissue, anchoring neural intermediate filaments to the actin cytoskeleton, and some isoforms are expressed in epithelial tissue, anchoring keratin-containing intermediate filaments to hemidesmosomes. Consistent with the expression, mice defective for this gene show skin blistering and neurodegeneration.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42,618 Da
NCBI Official Full Name
dystonin isoform 4
NCBI Official Synonym Full Names
dystonin
NCBI Official Symbol
Dst
NCBI Official Synonym Symbols
ah; dt; Bpag; BP230; Bpag1; Macf2; nmf203; nmf339; BPAG1-n; AW554249; athetoid; mKIAA0728; 2310001O04Rik; A830042E19Rik
NCBI Protein Information
dystonin
UniProt Protein Name
Dystonin
Protein Family
UniProt Gene Name
Dst
UniProt Synonym Gene Names
Bpag1; Macf2; BPA
Uniprot Description
Cytoskeletal linker protein. Acts as an integrator of intermediate filaments, actin and microtubule cytoskeleton networks. Required for anchoring either intermediate filaments to the actin cytoskeleton in neural and muscle cells or keratin-containing intermediate filaments to hemidesmosomes in epithelial cells. The proteins may self-aggregate to form filaments or a two-dimensional mesh. Regulates the organization and stability of the microtubule network of sensory neurons to allow axonal transport. Mediates docking of the dynein/dynactin motor complex to vesicle cargos for retrograde axonal transport through its interaction with TMEM108 and DCTN1.
Research Articles on Dst
Similar Products
Product Notes
The Dst dst (Catalog #AAA1375581) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 35-352, Partial, provide the Actin-binding domain. The amino acid sequence is listed below: KVQKKTFTKW INQHLMKVRK HVNDLYEDLR DGHNLISLLE VLSGDTLPRE KGRMRFHRLQ NVQIALDYLK RRQVKLVNIR NDDITDGNPK LTLGLIWTII LHFQISDIHV TGESEDMSAK ERLLLWTQQA TEGYAGVRCE NFTTCWRDGK LFNAIIHKYR PDLIDMNTVA VQSNLANLEH AFYVAEKIGV IRLLDPEDVD VSSPDEKSVI TYVSSLYD . It is sometimes possible for the material contained within the vial of "Dystonin (Dst), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
