Putative protein-disulfide oxidoreductase (CJJ81176_0881) Recombinant Protein | dsbB recombinant protein
Recombinant Campylobacter jejuni subsp. jejuni serotype O:23/36 Putative protein-disulfide oxidoreductase (CJJ81176_0881)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Putative protein-disulfide oxidoreductase (CJJ81176_0881); Recombinant Campylobacter jejuni subsp. jejuni serotype O:23/36 Putative protein-disulfide oxidoreductase (CJJ81176_0881); Recombinant Putative protein-disulfide oxidoreductase (CJJ81176_0881); Putative protein-disulfide oxidoreductase; dsbB recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-269
Sequence
MSCIKMKDNCRNFSLSKWQDTRKPWLILIIVTIGLTCIAHFLFQEYLFMEPCEQCVYIRFDMLVMAIGGMIALINPTNNIIKIFSYSLAFYGIWLGLEHCLTLNHIHEVVHSENPFAGVDGCREIPIYPFNLPLHEWAPSWFLPIGECGMDTPVVPENAYNHLNAFQKFFIGTPPDFENGLYSNGWYLIPSLKFINMAICCLIAFLCCFIVLFAMFIAYVLDKNKPNAKIFALAIVILVLVLKFIGEPKNPNQNIASLNHLNQVVLRYS
Sequence Length
269
Species
Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30,798 Da
NCBI Official Full Name
putative disulfide oxidoreductase
NCBI Official Symbol
dsbB
NCBI Protein Information
putative disulfide oxidoreductase
UniProt Protein Name
Protein-disulfide oxidoreductase DsbI
Protein Family
UniProt Gene Name
dsbI
UniProt Entry Name
DSBI_CAMJJ
Uniprot Description
Function: Required for disulfide bond formation in some proteins. Part of a redox system composed of DsbI and DsbL that mediates formation of an essential disulfide bond in AssT
By similarity. HAMAP-Rule MF_01311
Subunit structure: Interacts with DsbL
By similarity. HAMAP-Rule MF_01311
Subcellular location: Cell inner membrane; Multi-pass membrane protein
By similarity HAMAP-Rule MF_01311.
Sequence similarities: Belongs to the DsbB family. DsbI subfamily.
Caution: Was originally given the gene name dsbB; however this seems to belong to a different DsbB subfamily.
Sequence caution: The sequence EAQ72274.1 differs from that shown. Reason: Erroneous initiation.
Similar Products
Product Notes
The dsbB dsbi (Catalog #AAA1244521) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-269. The amino acid sequence is listed below: MSCIKMKDNC RNFSLSKWQD TRKPWLILII VTIGLTCIAH FLFQEYLFME PCEQCVYIRF DMLVMAIGGM IALINPTNNI IKIFSYSLAF YGIWLGLEHC LTLNHIHEVV HSENPFAGVD GCREIPIYPF NLPLHEWAPS WFLPIGECGM DTPVVPENAY NHLNAFQKFF IGTPPDFENG LYSNGWYLIP SLKFINMAIC CLIAFLCCFI VLFAMFIAYV LDKNKPNAKI FALAIVILVL VLKFIGEPKN PNQNIASLNH LNQVVLRYS. It is sometimes possible for the material contained within the vial of "Putative protein-disulfide oxidoreductase (CJJ81176_0881), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
