Disulfide bond formation protein B 2 (dsbB2) Recombinant Protein | dsbB recombinant protein
Recombinant Pseudomonas aeruginosa Disulfide bond formation protein B 2 (dsbB2)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Disulfide bond formation protein B 2 (dsbB2); Recombinant Pseudomonas aeruginosa Disulfide bond formation protein B 2 (dsbB2); Recombinant Disulfide bond formation protein B 2 (dsbB2); Disulfide bond formation protein B 2; Disulfide oxidoreductase 2; dsbB recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-169
Sequence
MSALLKPLDNRLFWPAVAIGGLLILAFVLYLQHVRGFAPCSLCIFIRLDVLGLVLAGIVGSLAPRSRIAGGIAALGMLAASLGGIYHAWSLVAEEKLAAQGMGSCKMFMGFPEWIPLDTWLPQVFQPEGLCGEVVWTLLGQSMAVWSLALFVFCLLVLAAKLAFGRRTA
Sequence Length
169
Species
Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
18,132 Da
NCBI Official Full Name
disulfide bond formation protein
NCBI Official Symbol
dsbB
NCBI Protein Information
disulfide bond formation protein
UniProt Protein Name
Disulfide bond formation protein B 2
Protein Family
UniProt Gene Name
dsbB2
UniProt Entry Name
DSBB2_PSEAE
Uniprot Description
Function: Required for disulfide bond formation in some periplasmic proteins. Acts by oxidizing the DsbA protein
By similarity. HAMAP-Rule MF_00286
Subcellular location: Cell inner membrane; Multi-pass membrane protein
By similarity HAMAP-Rule MF_00286.
Sequence similarities: Belongs to the DsbB family.
Similar Products
Product Notes
The dsbB dsbb2 (Catalog #AAA1035760) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-169. The amino acid sequence is listed below: MSALLKPLDN RLFWPAVAIG GLLILAFVLY LQHVRGFAPC SLCIFIRLDV LGLVLAGIVG SLAPRSRIAG GIAALGMLAA SLGGIYHAWS LVAEEKLAAQ GMGSCKMFMG FPEWIPLDTW LPQVFQPEGL CGEVVWTLLG QSMAVWSLAL FVFCLLVLAA KLAFGRRTA. It is sometimes possible for the material contained within the vial of "Disulfide bond formation protein B 2 (dsbB2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
