Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Dehydration-responsive element-binding protein 1F (DREB1F) Recombinant Protein | DREB1F recombinant protein

Recombinant Arabidopsis thaliana Dehydration-responsive element-binding protein 1F (DREB1F)

Gene Names
DDF1; DWARF AND DELAYED FLOWERING 1; T12C24.14; T12C24_14
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Dehydration-responsive element-binding protein 1F (DREB1F); Recombinant Arabidopsis thaliana Dehydration-responsive element-binding protein 1F (DREB1F); DREB1F recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-209, Full length protein
Sequence
MNNDDIILAEMRPKKRAGRRVFKETRHPVYRGIRRRNGDKWVCEVREPTHQRRIWLGTYPTADMAARAHDVAVLALRGRSACLNFADSAWRLPVPESNDPDVIRRVAAEAAEMFRPVDLESGITVLPCAGDDVDLGFGSGSGSGSGSEERNSSSYGFGDYEEVSTTMMRLAEGPLMSPPRSYMEDMTPTNVYTEEEMCYEDMSLWSYRY
Sequence Length
209
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23,616 Da
NCBI Official Full Name
Integrase-type DNA-binding superfamily protein
NCBI Official Symbol
DDF1
NCBI Official Synonym Symbols
DWARF AND DELAYED FLOWERING 1; T12C24.14; T12C24_14
NCBI Protein Information
Integrase-type DNA-binding superfamily protein
UniProt Protein Name
Dehydration-responsive element-binding protein 1F
UniProt Gene Name
DREB1F
UniProt Synonym Gene Names
DDF2; ERF033; Protein DREB1F

NCBI Description

Encodes a member of the DREB subfamily A-1 of ERF/AP2 transcription factor family (DDF1). The protein contains one AP2 domain. There are six members in this subfamily, including CBF1, CBF2, and CBF3. Overexpression of this gene results in delayed flowering and dwarfism, reduction of gibberellic acid biosynthesis, and increased tolerance to high levels of salt. This gene is expressed in all tissues examined, but most abundantly expressed in upper stems. Overexpression of this gene is also correlated with increased expression of GA biosynthetic genes and RD29A (a cold and drought responsive gene). Under salt stress it induces the expression of GAOX7, which encodes ad C20-GA inhibitor.

Uniprot Description

Transcriptional activator that binds specifically to the DNA sequence 5'-[AG]CCGAC-3'. Binding to the C-repeat/DRE element mediates cold or dehydration-inducible transcription. CBF/DREB1 factors play a key role in freezing tolerance and cold acclimation.

Research Articles on DREB1F

Similar Products

Product Notes

The DREB1F dreb1f (Catalog #AAA1296108) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-209, Full length protein. The amino acid sequence is listed below: MNNDDIILAE MRPKKRAGRR VFKETRHPVY RGIRRRNGDK WVCEVREPTH QRRIWLGTYP TADMAARAHD VAVLALRGRS ACLNFADSAW RLPVPESNDP DVIRRVAAEA AEMFRPVDLE SGITVLPCAG DDVDLGFGSG SGSGSGSEER NSSSYGFGDY EEVSTTMMRL AEGPLMSPPR SYMEDMTPTN VYTEEEMCYE DMSLWSYRY. It is sometimes possible for the material contained within the vial of "Dehydration-responsive element-binding protein 1F (DREB1F), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.