Dipeptide transport system permease protein dppB (dppB) Recombinant Protein | dppB recombinant protein
Recombinant Bacillus subtilis Dipeptide transport system permease protein dppB (dppB)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Dipeptide transport system permease protein dppB (dppB); Recombinant Bacillus subtilis Dipeptide transport system permease protein dppB (dppB); Recombinant Dipeptide transport system permease protein dppB (dppB); Dipeptide transport system permease protein dppB; dppB recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-308
Sequence
MARYMIKRFWAMAATILVITTLTFVLMKVIPGSPFNEERGTNEAVQKNLEAYYHLDDPLIFQYIFYLKSIITFDFGPSIKKPSDSVNDMLERGFPVSFELGMTAIVIAVISGLVLGVIAALRRNGFLDYAAMSLAVLGISIPNFILATLLIQQFAVNLKLFPAATWTSPIHMVLPTAALAVGPMAIIARLTRSSMVEVLTQDYIRTAKAKGLSPFKIIVKHALRNALMPVITVLGTLVASILTGSFVIEKIFAIPGMGKYFVESINQRDYPVIMGTTVFYSVILIIMLFLVDLAYGLLDPRIKLHKKG
Sequence Length
308
Species
Bacillus subtilis (strain 168)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34,056 Da
NCBI Official Full Name
dipeptide ABC transporter permease
NCBI Official Symbol
dppB
NCBI Protein Information
dipeptide ABC transporter permease
UniProt Protein Name
Dipeptide transport system permease protein DppB
Protein Family
UniProt Gene Name
dppB
UniProt Synonym Gene Names
dciAB
UniProt Entry Name
DPPB_BACSU
Uniprot Description
Function: Part of the binding-protein-dependent transport system for dipeptides; probably responsible for the translocation of the substrate across the membrane. Is expressed to facilitate adaptation to nutrient deficiency conditions.
Subcellular location: Cell membrane; Multi-pass membrane protein
Potential.
Developmental stage: Expressed early during sporulation.
Induction: Nutrient deficiency conditions, which also induce sporulation.
Sequence similarities: Belongs to the binding-protein-dependent transport system permease family. OppBC subfamily.Contains 1 ABC transmembrane type-1 domain.
Similar Products
Product Notes
The dppB dppb (Catalog #AAA1060882) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-308. The amino acid sequence is listed below: MARYMIKRFW AMAATILVIT TLTFVLMKVI PGSPFNEERG TNEAVQKNLE AYYHLDDPLI FQYIFYLKSI ITFDFGPSIK KPSDSVNDML ERGFPVSFEL GMTAIVIAVI SGLVLGVIAA LRRNGFLDYA AMSLAVLGIS IPNFILATLL IQQFAVNLKL FPAATWTSPI HMVLPTAALA VGPMAIIARL TRSSMVEVLT QDYIRTAKAK GLSPFKIIVK HALRNALMPV ITVLGTLVAS ILTGSFVIEK IFAIPGMGKY FVESINQRDY PVIMGTTVFY SVILIIMLFL VDLAYGLLDP RIKLHKKG. It is sometimes possible for the material contained within the vial of "Dipeptide transport system permease protein dppB (dppB), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
