Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Dolichol-phosphate mannosyltransferase subunit 3 (DPM3) Recombinant Protein | DPM3 recombinant protein

Recombinant Human Dolichol-phosphate mannosyltransferase subunit 3 (DPM3)

Gene Names
DPM3; CDG1O
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Dolichol-phosphate mannosyltransferase subunit 3 (DPM3); Recombinant Human Dolichol-phosphate mannosyltransferase subunit 3 (DPM3); DPM3 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-92aa; full length protein
Sequence
MTKLAQWLWGLAILGSTWVALTTGALGLELPLSCQEVLWPLPAYLLVSAGCYALGTVGYR VATFHDCEDAARELQSQIQEARADLARRGLRF
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Human
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for DPM3 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
13,277 Da
NCBI Official Full Name
dolichol-phosphate mannosyltransferase subunit 3 isoform 1
NCBI Official Synonym Full Names
dolichyl-phosphate mannosyltransferase subunit 3
NCBI Official Symbol
DPM3
NCBI Official Synonym Symbols
CDG1O
NCBI Protein Information
dolichol-phosphate mannosyltransferase subunit 3
UniProt Protein Name
Dolichol-phosphate mannosyltransferase subunit 3
UniProt Gene Name
DPM3
UniProt Synonym Gene Names
DPM synthase subunit 3; MPD synthase subunit 3
UniProt Entry Name
DPM3_HUMAN

NCBI Description

Dolichol-phosphate mannose (Dol-P-Man) serves as a donor of mannosyl residues on the lumenal side of the endoplasmic reticulum (ER). Lack of Dol-P-Man results in defective surface expression of GPI-anchored proteins. Dol-P-Man is synthesized from GDP-mannose and dolichol-phosphate on the cytosolic side of the ER by the enzyme dolichyl-phosphate mannosyltransferase. The protein encoded by this gene is a subunit of dolichyl-phosphate mannosyltransferase and acts as a stabilizer subunit of the dolichyl-phosphate mannosyltransferase complex. [provided by RefSeq, Jul 2008]

Uniprot Description

DPM3: Stabilizer subunit of the dolichol-phosphate-mannose synthase complex. Defects in DPM3 are the cause of congenital disorder of glycosylation type 1O (CDG1O). A multisystem disorder caused by a defect in glycoprotein biosynthesis and characterized by under-glycosylated serum glycoproteins. Congenital disorders of glycosylation result in a wide variety of clinical features, such as defects in the nervous system development, psychomotor retardation, dysmorphic features, hypotonia, coagulation disorders, and immunodeficiency. The broad spectrum of features reflects the critical role of N-glycoproteins during embryonic development, differentiation, and maintenance of cell functions. Belongs to the DPM3 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, multi-pass; Endoplasmic reticulum; Transferase; Membrane protein, integral

Chromosomal Location of Human Ortholog: 1q22

Cellular Component: endoplasmic reticulum; endoplasmic reticulum membrane; integral to endoplasmic reticulum membrane; mannosyltransferase complex; membrane

Molecular Function: dolichyl-phosphate beta-D-mannosyltransferase activity; protein binding

Biological Process: carbohydrate metabolic process; GPI anchor biosynthetic process; protein amino acid C-linked glycosylation via 2'-alpha-mannosyl-L-tryptophan; protein amino acid mannosylation; protein amino acid N-linked glycosylation via asparagine; protein amino acid O-linked mannosylation; regulation of protein stability

Disease: Congenital Disorder Of Glycosylation, Type Io

Similar Products

Product Notes

The DPM3 dpm3 (Catalog #AAA7013856) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-92aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the DPM3 dpm3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MTKLAQWLWG LAILGSTWVA LTTGALGLEL PLSCQEVLWP LPAYLLVSAG CYALGTVGYR VATFHDCEDA ARELQSQIQE ARADLARRGL RF. It is sometimes possible for the material contained within the vial of "Dolichol-phosphate mannosyltransferase subunit 3 (DPM3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.