Primosomal protein 1 (dnaT) Recombinant Protein | dnaT recombinant protein

Recombinant Escherichia coli O157:H7 Primosomal protein 1 (dnaT)

Purity

Greater or equal to 85% purity as determined by SDS-PAGE.

Synonyms

Primosomal protein 1 (dnaT); Recombinant Escherichia coli O157:H7 Primosomal protein 1 (dnaT); dnaT recombinant protein

Ordering
Cat. Num. AAA1172013 When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures. For Research Use Only!

Host

E Coli or Yeast or Baculovirus or Mammalian Cell

Purity/Purification

Greater or equal to 85% purity as determined by SDS-PAGE.

Form/Format

Lyophilized or liquid (Format to be determined during the manufacturing process)

Sequence Positions

1-179, Full length protein

Sequence

MSSRVLTPDVVGIDALVHDHQTVLAKAEGGVVAVFANNAPAFYAVTPARLAELLALEEKLARPGSDVDLDDQLYQEPQAAPVAVPMGKFAMYPDWQPDADFIRLAALWGVALREPVTTEELASFIAYWQAEGKVFHHVQWQQKLARSLQIGRASNGGLPKRDVNTVSEPDSQIPPGFRG

Sequence Length

179

Species

Escherichia coli O157:H7 (strain EC4115 / EHEC)

Preparation and Storage

Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #

446020966

NCBI Accession #

WP_000098821.1

NCBI GenBank Nucleotide #

WP_000098821.1

UniProt Accession #

B5Z4P5

Molecular Weight

19,499 Da

NCBI Official Full Name

primosomal protein 1

UniProt Protein Name

Primosomal protein 1

Protein Family

Primosomal protein

UniProt Gene Name

dnaT

Uniprot Description

This protein is required for primosome-dependent normal DNA replication; it is also involved in inducing stable DNA replication during SOS response. It forms, in concert with DnaB protein and other prepriming proteins DnaC, N, N', N'' a prepriming protein complex on the specific site of the template DNA recognized by protein N'.

Similar Products

Product Notes

The dnaT dnat (Catalog #AAA1172013) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-179, Full length protein. The amino acid sequence is listed below: MSSRVLTPDV VGIDALVHDH QTVLAKAEGG VVAVFANNAP AFYAVTPARL AELLALEEKL ARPGSDVDLD DQLYQEPQAA PVAVPMGKFA MYPDWQPDAD FIRLAALWGV ALREPVTTEE LASFIAYWQA EGKVFHHVQW QQKLARSLQI GRASNGGLPK RDVNTVSEPD SQIPPGFRG. It is sometimes possible for the material contained within the vial of "Primosomal protein 1 (dnaT), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Loading...