Dynein light chain 1, axonemal (Dnal1) Recombinant Protein | Dnal1 recombinant protein
Recombinant Mouse Dynein light chain 1, axonemal (Dnal1)
Gene Names
Dnal1; Dnalc1; AW121714; 1700010H15Rik; E330027P08Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Dynein light chain 1; axonemal (Dnal1); Recombinant Mouse Dynein light chain 1; Dnal1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-190, Full length protein
Sequence
AKATTIKEALSRWEEKTGQKPSDAKEIKLYAQIPPIEKMDASLSTLGNCEKLSLSTNCIEKIANLNGLKNLRILSLGRNNIKNLNGLEAVGETLEELWISYNFIEKLKGIHVMKKLKILYMSNNLVKDWAEFLKLAELPCLEDLVFVGNPLEEKHSAEGNWIDEATKRVPKLKKLDGTPVIKEDEEEES
Sequence Length
189
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
17,054 Da
NCBI Official Full Name
dynein light chain 1, axonemal isoform 2
NCBI Official Synonym Full Names
dynein, axonemal, light chain 1
NCBI Official Symbol
Dnal1
NCBI Official Synonym Symbols
Dnalc1; AW121714; 1700010H15Rik; E330027P08Rik
NCBI Protein Information
dynein light chain 1, axonemal
UniProt Protein Name
Dynein light chain 1, axonemal
Protein Family
UniProt Gene Name
Dnal1
UniProt Synonym Gene Names
Dnalc1
Uniprot Description
Part of the multisubunit axonemal ATPase complexes that generate the force for cilia motility and govern beat frequency (). Component of the outer arm dynein (ODA). May be involved in a mechanosensory feedback mechanism controlling ODA activity based on external conformational cues by tethering the outer arm dynein heavy chain (DNAH5) to the microtubule within the axoneme (). Important for ciliary function in the airways and for the function of the cilia that produce the nodal flow essential for the determination of the left-right asymmetry ().
Research Articles on Dnal1
Similar Products
Product Notes
The Dnal1 dnal1 (Catalog #AAA957712) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-190, Full length protein. The amino acid sequence is listed below: AKATTIKEAL SRWEEKTGQK PSDAKEIKLY AQIPPIEKMD ASLSTLGNCE KLSLSTNCIE KIANLNGLKN LRILSLGRNN IKNLNGLEAV GETLEELWIS YNFIEKLKGI HVMKKLKILY MSNNLVKDWA EFLKLAELPC LEDLVFVGNP LEEKHSAEGN WIDEATKRVP KLKKLDGTPV IKEDEEEES. It is sometimes possible for the material contained within the vial of "Dynein light chain 1, axonemal (Dnal1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
