DnaJ homolog subfamily C member 22 (dnajc22) Recombinant Protein | dnajc22 recombinant protein
Recombinant Xenopus tropicalis DnaJ homolog subfamily C member 22 (dnajc22)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
DnaJ homolog subfamily C member 22 (dnajc22); Recombinant Xenopus tropicalis DnaJ homolog subfamily C member 22 (dnajc22); Recombinant DnaJ homolog subfamily C member 22 (dnajc22); DnaJ homolog subfamily C member 22; dnajc22 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-340
Sequence
MGKSLLAAYGLWALGGPLGLYHIYLGRDSHALLWMLTLGGFGMGWMWDFWKIPIHVYKYNRQERKNIEVKEGEPPASPIRFIGQVATGIYFGIVAAIGLSFLSSFHMVVLPLAVALGVHLVATVGEQTSDLKNTLIAAFLTSPIFYGRAVSMIPISLTASITSQKHMRYRLQQEKQEKLSLRLYRIGLVYLAFTGPLAYSALLNTSLTVSYVAGSIGSMLEWLSIFPSISALVERLLLLPYRVWAVFSGGGVFRDHYFKEWEKIYEFVATFQSEKEEMACKVLGVNFKSTMEEINRKYRELVKIWHPDHNRHRLEEAQEHFLEIQAAYETLMRLRKSKTL
Sequence Length
340
Species
Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38,721 Da
NCBI Official Full Name
dnaJ homolog subfamily C member 22
NCBI Official Synonym Full Names
DnaJ (Hsp40) homolog, subfamily C, member 22
NCBI Official Symbol
dnajc22
NCBI Protein Information
dnaJ homolog subfamily C member 22; DnaJ homolog subfamily B member 15
UniProt Protein Name
DnaJ homolog subfamily C member 22
Protein Family
UniProt Gene Name
dnajc22
UniProt Entry Name
DJC22_XENTR
Uniprot Description
Function: May function as a co-chaperone.
Subcellular location: Membrane; Multi-pass membrane protein
Potential.
Sequence similarities: Contains 1 J domain.
Similar Products
Product Notes
The dnajc22 dnajc22 (Catalog #AAA1207115) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-340. The amino acid sequence is listed below: MGKSLLAAYG LWALGGPLGL YHIYLGRDSH ALLWMLTLGG FGMGWMWDFW KIPIHVYKYN RQERKNIEVK EGEPPASPIR FIGQVATGIY FGIVAAIGLS FLSSFHMVVL PLAVALGVHL VATVGEQTSD LKNTLIAAFL TSPIFYGRAV SMIPISLTAS ITSQKHMRYR LQQEKQEKLS LRLYRIGLVY LAFTGPLAYS ALLNTSLTVS YVAGSIGSML EWLSIFPSIS ALVERLLLLP YRVWAVFSGG GVFRDHYFKE WEKIYEFVAT FQSEKEEMAC KVLGVNFKST MEEINRKYRE LVKIWHPDHN RHRLEEAQEH FLEIQAAYET LMRLRKSKTL. It is sometimes possible for the material contained within the vial of "DnaJ homolog subfamily C member 22 (dnajc22), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
